SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019412 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019412
Domain Number 1 Region: 19-117
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-21
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Domain Number 2 Region: 1010-1150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000283
Family Nucleotide and nucleoside kinases 0.003
Further Details:      
 
Domain Number 3 Region: 681-761
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000058
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019412
Domain Number - Region: 178-439
Classification Level Classification E-value
Superfamily Tropomyosin 0.0242
Family Tropomyosin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019412   Gene: ENSPPYG00000017323   Transcript: ENSPPYT00000020178
Sequence length 1155
Comment pep:novel chromosome:PPYG2:7:2880729:3026873:-1 gene:ENSPPYG00000017323 transcript:ENSPPYT00000020178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEV
LNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVV
EEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEKKQMTLTRVELLTFQERY
YKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKME
EECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQELQSIIQAGKRSLPDSDKA
ILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDLELKCSTLGKDCEM
YKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIE
MVRREACIVNLESKLRRLSKDSSNLDQSLPRNLPVTIISQDFGDASPRTNGQEADDSSTS
EESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGMDASPSSCG
SLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSTVEEDNDSGGFDALD
LDDDSHERYSFGPSSVHSSSSSHQSEGLDAYDLEQVNLMFRKFSLERPFRPSVTSVRGHV
RGPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHSVKPGSLAEKAGLREGHQLLLLEGCI
RGERQSVPLDTCTKEEAHWTIQRCSGPVTLHYKVNHEGYRKLVKDMEDGLITSGDSFYIR
LNLNISSQLDACTMSLKCDDVVHVRDTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQ
QLLLVKLQRLMHRGSREEVDGTHHTLRTLRNTLQPEEALSTSDPRVSPRLSRASFLFGQL
LQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSLDATKLLTEKQEELDPESELGKNLS
LIPYSLVRAFYCERRRPVLFTPTVLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQK
TETIIYSREKNPNAFECITPANIEAVAAKNKHCLLEAGIGCTRDLIKSNIYPIVLFIRVC
EKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKI
GEEQRKTIWVDEDQL
Download sequence
Identical sequences H2PLD1
ENSPPYP00000019412 ENSPPYP00000019412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]