SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021136 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021136
Domain Number 1 Region: 234-314
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000673
Family DEATH domain, DD 0.027
Further Details:      
 
Domain Number 2 Region: 59-110
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000306
Family TNF receptor-like 0.0059
Further Details:      
 
Domain Number 3 Region: 130-187
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000121
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 4 Region: 320-398
Classification Level Classification E-value
Superfamily DEATH domain 0.00000111
Family DEATH domain, DD 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021136   Gene: ENSPPYG00000018838   Transcript: ENSPPYT00000021979
Sequence length 428
Comment pep:known chromosome:PPYG2:8:126514536:126544041:-1 gene:ENSPPYG00000018838 transcript:ENSPPYT00000021979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARAAETHRSARPAAASKRLRFPGTTMNKLLCCALVFLDISIKWTTQETFPPKYLHYDE
ETSHQLLCDKCPPGTYLKQHCTAKWKTMCAPCPDHYYTDNWHTSDECLYCSPVCKELQYV
KQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNE
TSSKAPCRKHANCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPT
KFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQD
IDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTTKACKPSDQILKLLSLWR
IKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQV
QSVKISCL
Download sequence
Identical sequences H2PR28
XP_002819429.1.23681 ENSPPYP00000021136 ENSPPYP00000021136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]