SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021610 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021610
Domain Number 1 Region: 271-507
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-63
Family Nuclear receptor ligand-binding domain 0.00000000146
Further Details:      
 
Domain Number 2 Region: 67-152
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-31
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021610   Gene: ENSPPYG00000019294   Transcript: ENSPPYT00000022495
Sequence length 516
Comment pep:known chromosome:PPYG2:9:69308644:69505687:1 gene:ENSPPYG00000019294 transcript:ENSPPYT00000022495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRRQTSPCSHGVRLKGWFSRQSSSSPTTFFTRAERDFWALRGSGWEQLHDYAERESGHT
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALAR
VYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQ
EPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQ
THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCL
EVVLVRCAVPSPINTVLFEEIWRMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFS
SAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLH
GEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK
Download sequence
Identical sequences H2PSE1
ENSPPYP00000021610 9600.ENSPPYP00000021610 ENSPPYP00000021610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]