SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022178 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022178
Domain Number 1 Region: 110-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 27-149
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000628
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022178   Gene: ENSPPYG00000019779   Transcript: ENSPPYT00000023091
Sequence length 246
Comment pep:known chromosome:PPYG2:9:133656577:133660040:1 gene:ENSPPYG00000019779 transcript:ENSPPYT00000023091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRVCALQPHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYA
CCPGWKRTSGLPRACGAAICQPPCRNGGSCVQPGRCRCPAGWQGDTCQSDVDECSARGGG
CPQRCVNTAGSYWCQCWGGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRV
DLLEEKLQLVLAPLHSLASQALEHGLPDPSSLLVHSLQQLGRIDSLSEQISFLEEQLGSC
SCKKDS
Download sequence
Identical sequences H2PTZ4
ENSPPYP00000022178 9600.ENSPPYP00000022178 ENSPPYP00000022178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]