SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022629 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022629
Domain Number 1 Region: 8-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.72e-79
Family Calponin-homology domain, CH-domain 0.000000689
Further Details:      
 
Domain Number 2 Region: 3044-3167
Classification Level Classification E-value
Superfamily EF-hand 9.08e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 3 Region: 3169-3265
Classification Level Classification E-value
Superfamily EF-hand 6.8e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 4 Region: 2009-2166
Classification Level Classification E-value
Superfamily Spectrin repeat 6.05e-23
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 954-1110
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-22
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 6 Region: 2117-2274
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 7 Region: 3245-3333
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 8 Region: 1061-1221
Classification Level Classification E-value
Superfamily Spectrin repeat 7.34e-19
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 9 Region: 2483-2645
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-18
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 336-446
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-18
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 11 Region: 1171-1325
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 2712-2837
Classification Level Classification E-value
Superfamily Spectrin repeat 6.34e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 13 Region: 2860-2998
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-17
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 14 Region: 1477-1632
Classification Level Classification E-value
Superfamily Spectrin repeat 9.85e-16
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 15 Region: 455-558
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000109
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 16 Region: 522-660
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000458
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 17 Region: 1586-1730
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000128
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 18 Region: 1781-1925
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000212
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 19 Region: 3006-3043
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 20 Region: 734-890
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000037
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 21 Region: 2242-2379
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000932
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 22 Region: 2429-2497
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000424
Family Spectrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000022629
Domain Number - Region: 1385-1513
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000691
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022629   Gene: ENSPPYG00000020222   Transcript: ENSPPYT00000023589
Sequence length 3618
Comment pep:known chromosome:PPYG2:X:31418882:33602627:-1 gene:ENSPPYG00000020222 transcript:ENSPPYT00000023589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWWEEVEDCYEREDVQKKTFTKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQ
KLPKEKGSTRVHALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQV
KNVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDL
FDWNSVVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVATTYPDKKSVLMYITSLFQVLP
QQVSIEAIQEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYA
YTQAAYVTTSDPTRSPFPSQHLEAPEDKTFGSSLMESEVNLDRYQTALEEVLSWLLSAED
TLQAQGEISNDVEVVKEQFHTHEGYMMDLTAHQGQVGNILQLGSKLIGTGKLSEDEETEV
QEQMTLLNSRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEEEPLG
PDLEDLKRQVQQHKVLQEDLEEEQVRVNSLTHMVLVVDESSGDHATAALEEQLQVLGDRW
ANICRWTEDRWVLLQDILLKWQRLTEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSL
QTLAVLKADLEKKKQSMGKLYSLKQDLLSALKNKSVTQKTEAWLENFARCWDNLVQKLEK
STAQISQAVTTTQPSLTQTTVMETVTMVTTREQILVKHAQEELPPPPPQKKRQITVDSEI
RKAIEREKAEKFRKLQDASRSAQALVEQMVNEGVNADSIKQASEQLNSRWIEFCQLLSER
LNWLEYQNNIITFYNQLQQLEQMTTTAENWLKIQPTTPSEPTAIKSQLKICKDEVNRLSA
LQPQIERLKIQSIALKEKGQGPMFLDADFVAFTNHFNQVFSDVQAREKELQTIFDTLPPM
RYQETMSAIRTWVQQSETKLSIPQLSVTDYEIMEQRLGELQALQSSLQEQQSGLNYLSTT
VKEMSKKAPSEISRKYQLEFEEIEGRWKKLSSQLVEHCQKLEEQMNKLRKIQNHIQTLKK
WMAEVDVFLKEEWPALGDSEILKKQLKQCRLLVNDIQTIQPSLNSVNEGGQKMKNEAEPE
FASRLETELKELNIQWDHMCQQVYARKEALKGGLEKTVSLQKDLSEMHEWMTQAEEEYLE
RDFEYKTPDELQKAVEEMKRAKEEAQQKEAKVKLLTESVNSVIAQAPPVAQEALKKELET
LTTNYQWLCTRLNGKCKTLEEVWACWHELLSYLEKANKWLNEVEFKLKTTENIPGGAEEI
SEVLDSLENLMRHSEDNPNQIRILAQTLTDGGVMDELINEELETFNSRWRELHEEAVRRQ
KLLEQSIQSAQETEKSLHLIQESLTFIDKQLAAYIADKVDAAQMPQEAQKIQSDLTSHEI
SLEEMKKHNQGKEAAQRVLSQIDVAQKKLQDVSMKFRLFQKPANFEQRLQESKMILDEVK
MHLPALETKSVEQEVVQSQLNHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELD
ERVTALKLHYNELGAKVTERKQQLEKCLKLSRKMRKEMNVLTEWLAATDMELTKRSAVEG
MPSNLDSEVAWGKATQKEIEKQKVHLKSITEVGEALKTVLGKKETLVEDKLSLLNSNWIA
VTSRAEEWLNLLLEYQKHMETFDQNVDHITKWIIQADTLLDELEKKKPQQKEDVLKRLKA
ELNDIRPKVDSTRDQAANLMANRGDHCRKLVEPQISELNHRFAAISHRIKTGKASIPLKE
LEQFNSDIQKLLEPLEAEIQQGVNLKEEDFNKDMNEDNEGTVKELLQRGDNLQQRITDER
KREEIKIKQQLLQTKHNALKDLRSQRRKKALEISHQWYQYKRQADDLLKCLDDIEKKLAS
LPEPRDERKIKEIDRELQKKKEELNAVRRQAEGLSEDGAAMAVEPTQIQLSKRWREIESK
FAQFRRLNFAQIHTVREETMMVMTEDMPLEISYVPSTYLTEITHVSQALSEVEQLLNAPD
LCAKDFEDLFKQEESLKNIKDSLQQSSGRIDIIHSKKTAALQSATPVERVKLQEALSQLD
FQWEKVNKMYKDRQGRFDRSVEKWRRFHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYK
WYLKELQDGIGQRQTVVRTLNATGEEIIQQSSKTDAGILQEKLGSLHLRWQEVCKQLSER
KKRLEEQKNILSEFQRDLNEFVLWLEEADNIASIPLEPGNEQQLKEKLEQVKLLVEELPL
RQGILKQLNETGGPVLVSAPISPEEQDKLENKLKQTTLQWIKVSRALPEKQGEIEAQIKE
LGQLEKKLEDLEEQLNHLLLWLSPIRNQLEIYNQPNQEGPFDIKETEIAVQAKQPDVEEI
LSKGQRLYKEKPATQPVKRKLEDLSSEWKAVNRLLQELRAKQPDLAPGLTTIGASPTQTV
TLVTQPVVTKETAISKLEMPSSLMLEVPALADFNRAWTELTDWLSLLDRVIKSQRVMVGD
LEDINEMIIKQKATMQDLEQRRPQLEELITAAQNLKNKTSNQEARTIITDRIERIQNQWD
EVQEHLQNRRQQLNEMLKDSTQWLEAKEEAEQVLGQARAKLESWKEGPYTIDAXXQKKIT
ETKQLAKDLRQWQINVDVANDLALKLLRDYSADDTRKVHMITENINASWGSIHKRVSERE
AALEETHRLLQQFPLDLEKFLAWLTEAETTANVLQDATRKERLLEDSKGVKELMKQWQDL
QGEIEAHTDVYHNLDENSQKILRSLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLE
ASSDQWKRLHLSLQELLVWLQLKDDELSRQTPIGGDFPAVQKQNDVHRAFKRELKTKEPV
IMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLH
SADWQRKIDETLERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKAL
RGEIAPLKENVSHVNDLARQLTTLGIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEA
HRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNV
RFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRL
EQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQ
VASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALF
LDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCF
FSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVL
EGDNMETPVTLINFWPVDSAPASSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISP
NESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESEERGELERILADLEEENRNLQ
AEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILED
HNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSEDDLLSPPQDTSTGLEEVMEQLNNSF
PSSRGRNTPGKPMREDTM
Download sequence
Identical sequences H2PV85
9600.ENSPPYP00000022629 ENSPPYP00000022629 ENSPPYP00000022629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]