SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022854 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022854
Domain Number 1 Region: 126-265
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000144
Family Second domain of FERM 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022854   Gene: ENSPPYG00000020418   Transcript: ENSPPYT00000023817
Sequence length 462
Comment pep:known chromosome:PPYG2:X:62905092:62906679:-1 gene:ENSPPYG00000020418 transcript:ENSPPYT00000023817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGTEGSAGQPGPAERYHRSSVSSVGARAADVLVYPADDTVVPLAVENLPSLSAHEGHRAV
RKILQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVATDEP
FLRFRRNMFFPKRRELQIRDKEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVRVQLVP
YQPGWPAACDLREKLDSFLPAHLCKRGQGLFAALRGHGARAGPGEQGLLNAYRQVQEVSS
DGGCETALDTHYRAYLPKCHELPFYGCAFFHGEVDKPAQGFLHRGGHKPVSVAISLEGVH
VIDSREKHVLLGLCFQELSWDHTSSEEEEPILWLEFDGDSEGTPVNKPLKIYSKQAELMS
SLIEYCIKLSQAAEPAGPQDSATGSHSDPSSSPAPVQRPKLQRQGSVVSSRIQHLSTIDY
VEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPNDSLEQG
Download sequence
Identical sequences H2PVV2
ENSPPYP00000022854 9600.ENSPPYP00000022854 ENSPPYP00000022854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]