SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022855 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022855
Domain Number 1 Region: 199-340
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-45
Family Third domain of FERM 0.000000106
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-38
Family Second domain of FERM 0.000000594
Further Details:      
 
Domain Number 3 Region: 490-577
Classification Level Classification E-value
Superfamily Moesin tail domain 4.71e-33
Family Moesin tail domain 0.0000039
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-26
Family First domain of FERM 0.00000998
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022855   Gene: ENSPPYG00000020419   Transcript: ENSPPYT00000023818
Sequence length 577
Comment pep:known chromosome:PPYG2:X:63014151:63088970:1 gene:ENSPPYG00000020419 transcript:ENSPPYT00000023818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKK
AQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE
MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQ
DEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA
NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences A0A096NAI5 A0A0D9RHQ0 A0A2K5I2X5 A0A2K5MBQ1 A0A2K5WCE4 A0A2K5ZCB7 A0A2K6DL37 A0A2K6MME5 A0A2K6P6A6 H2PVV3 H9FUP0 K7BGD7 P26038 V9HWC0
9600.ENSPPYP00000022855 9606.ENSP00000353408 ENSPPYP00000022855 ENSP00000353408 ENSPPYP00000022855 ENSP00000353408 ENSNLEP00000000536 NP_001244625.1.72884 NP_002435.1.87134 NP_002435.1.92137 XP_002831790.1.23681 XP_003816963.1.60992 XP_007990112.1.81039 XP_010377679.1.97406 XP_011731166.1.29376 XP_011817388.1.43180 XP_011821673.1.47321 XP_011916306.1.92194 XP_015299475.1.63531 XP_016798611.1.37143 XP_017703931.1.44346 ENSPANP00000009698 ENSNLEP00000000536 ENSP00000353408 gi|4505257|ref|NP_002435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]