SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023353 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023353
Domain Number 1 Region: 190-428,470-513
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.57e-62
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 4-116
Classification Level Classification E-value
Superfamily DEATH domain 7.46e-25
Family DEATH domain, DD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023353   Gene: ENSPPYG00000020865   Transcript: ENSPPYT00000024330
Sequence length 682
Comment pep:known chromosome:PPYG2:X:154241788:154249860:-1 gene:ENSPPYG00000020865 transcript:ENSPPYT00000024330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPSTTAPRPSS
IPAPAEAEAWSPRKLPSSASTLLSPAFPGSQTHAGPELGVVPSPASLRPPPPSPAPSSTK
PGPESSVSLLQGAHPSPFCWPLCEISQGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKEDADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQSGFYCVVYGFLPNGSLEDRL
HCRTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAVPIAMQIYKKHLDP
RPGPCPPELGLGLGRLACCCLHRRAKRRPPMTQENSYVSSTGSAHSGAAPWQPPAAPSGA
SAQAAEHLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDMAGESS
WGSGPGFRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSS
SLPGLGLEQDRQGPEESDEFQS
Download sequence
Identical sequences H2PX74
ENSPPYP00000023353 9600.ENSPPYP00000023353 ENSPPYP00000023353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]