SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024067 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024067
Domain Number 1 Region: 71-149
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.32e-26
Family Intermediate filament protein, coiled coil region 0.0000214
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024067
Domain Number - Region: 14-68
Classification Level Classification E-value
Superfamily Prefoldin 0.00034
Family Prefoldin 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024067   Gene: ENSPPYG00000029437   Transcript: ENSPPYT00000033330
Sequence length 153
Comment pep:novel chromosome:PPYG2:2b:111287774:111291327:1 gene:ENSPPYG00000029437 transcript:ENSPPYT00000033330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMM
EYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMA
RHLREYQDLLNVKMALDVEIATYRKLLEGEESR
Download sequence
Identical sequences K7EU44
ENSPPYP00000024067 ENSPPYP00000024067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]