SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|TcIL3000.0.29570 from Trypanosoma congolense 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TcIL3000.0.29570
Domain Number 1 Region: 50-604
Classification Level Classification E-value
Superfamily SIS domain 1.31e-207
Family Phosphoglucose isomerase, PGI 0.000000000000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|TcIL3000.0.29570
Sequence length 607
Comment | organism=Trypanosoma_congolense | product= | location=T.congo_bin_contig_1174:2796-4619(-) | length=607
Sequence
MNQYLEELQLHVASSPARNGHVSMAVNSFNTPHEIRRRLMADEANVNVELTSSPSWKKLQ
RLYEQYGGEAIKKHFEGDAERHQRYSVKLDLRSEDGNFLFLDYSKTHINDEVKSALFELV
EELGVREFIRAVFRGERVNTTENRPVLHIALRNRSNRPILVDGKDVMPDVNKVLDQMHCF
SDKVRNGEWKGHTGKSIRHVVNIGIGGSDLGPVMATEALKPFSQRSISLHFVSNVDGTHI
SEVLKSIDIEATLFIVASKTFTTQETITNALSARNALLNYLKSQGINDDGAVAKHFVALS
TNTRKVKEFGIDEENMFQFWDWVGGRYSLWSAIGLPIMISIGYENFVELLTGAFVVDEHF
VNEPPERNIPMLLALVGVWYINFFGAVTHAILPYDQYLWRLPAYLQQLDMESNGKCVTRN
GETVSTLTGPIIFGEAGTNGQHAFYQLIHQGTNLIPCDFIGAIQTQNKIGDHHKIFMSNF
FAQTEALMIGKTPIEVRRELEAAGEKSADKIKALLPHKTFIGGRPSNTLLIKSLTPRALG
AIIAMYEHKVLVQGAIWGIDSYDQWGVELGKVLAKSILPQLKPGMKVNNHDSSTNGLINL
FNELSHL
Download sequence
Identical sequences F9W4E6
psu|TcIL3000.0.29570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]