SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|TcIL3000.7.4570 from Trypanosoma congolense 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TcIL3000.7.4570
Domain Number 1 Region: 268-645
Classification Level Classification E-value
Superfamily SIS domain 3.83e-87
Family double-SIS domain 0.00000123
Further Details:      
 
Domain Number 2 Region: 2-235
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.12e-46
Family Class II glutamine amidotransferases 0.00000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|TcIL3000.7.4570
Sequence length 646
Comment | organism=Trypanosoma_congolense | product=glucosamine-fructose-6-phosphate aminotransferase, putative | location=T.congo.pschr.7:1504992-1506932(+) | length=646
Sequence
VLNVLLDSLQRMEYRGYDSAGLCITDASTKKPVVFRSVGNVEKLRECVNRNAFGLDFNAE
LVDHEGIAHTRWATHGPPSEANCHPQVSNKTEFVVVHNGIITNFMEVKQMLLKSGYFFSS
ETDTEVIAVLGQHLFSQEPSIGFTVLMKKVMSMLDGAYGLLVKSVHFPNELIACRKGSPL
VVGIKPGKDEGSSNVNAENRVVNELYFSSDVLSFLPYTEEVIFLMDDDIAHYSCGVLSFH
TAAAGESAPLPVTRTSQRVSISSEGLSKGLYPSFMMKEIHEQPESIARSMRGRVDFNNGV
VEFDNMEENVYLSLCSARRLMLVACGTSFHSCLASRPIFEELLPHISITVENAPDLVDRE
PRISGDDACVFVSQSGETADTLMALQYCKPCGAFTLGLANVAGSSVLRLCHSSILLNAGV
EVGVASTKAYTSQIVVLTLLALCLSKRSCEGRSQLNGRNTTDINKRCSDILQGLASLPGA
VATCLKSTGDIAMGLAKEWQNANAILILGRGYDYATALESALKVKELTYIHTEGIHSGEL
KHGPLALVDEDSVIVAFCPHDKFFARSKSAIQQVKARGGRVVAITTAPDEELTKATVQCI
EVPTVVDFLQGVVNVVPLQLLSHHLAQCRGLNVDCPRNLAKSVTVQ
Download sequence
Identical sequences G0UQI2
psu|TcIL3000.7.4570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]