SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|TcIL3000.0.25380 from Trypanosoma congolense 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TcIL3000.0.25380
Domain Number 1 Region: 211-414,440-513
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.92e-51
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000681
Further Details:      
 
Domain Number 2 Region: 4-235
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.08e-49
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|TcIL3000.0.25380
Sequence length 548
Comment | organism=Trypanosoma_congolense | product= | location=T.congo_bin_contig_1002:6419-8065(-) | length=548
Sequence
MNLLCPFWINKIPRLRTDSPSALSLADLLYCNVEDPNEVWTHVILGGYVIDVEWLFRVSG
PLLMSKCTIVLISGEKGFLHKYRHLVLHDRFGRNRVKIVEPCLPIPFGVHHSKMMLCINN
NGIRVAVLTANFIEDDWNYKTQGIYFQDFPRLKTQSENIVLNISSIEGKGMRFRNEIKRY
LSCIGVASSMPKDGCIPLSLLDEFDFSGACVELIASVPGYHRCSDAQHYGLGKLKSILQS
MQLPSSLDRNPPVLTWQFTSQGLLTANFLNSMKQIMSIDARNPTGEDKMDPVVRVVYPTE
TEVKNSLEGWRGGLSLPVTLRCCHSYINERLFRWGTVPQGSEVENERSKGLPHLKTYTRL
TESEDGLSWFLLTSANLSRAAWGEWQHGGTQLLIRSYELGVLYDETSFLHVKEDGLFSVT
PSRPVPIPSSADGDGLVRVTIKADTCKKDGGGAALFLPYNPLTLQPYVSTVQIQERRTNA
LAERSKSPLSTTDVPWVVDVPHHGEDRFGKEFHDVLSGDNPCKEYLHASHRLSRSNSQIR
KKRMKYDN
Download sequence
Identical sequences F9W357
psu|TcIL3000.0.25380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]