SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_00667T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_00667T0
Domain Number 1 Region: 747-799,844-894
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-18
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 
Domain Number 2 Region: 11-75
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000249
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 3 Region: 250-322
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000523
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TEQG_00667T0
Sequence length 992
Sequence
MPQRPTSARDAHPGDVLLVNHDFDARGADELTLRRGDKVELLELDEGFGDGWYLGRHVTE
NRTGLFPGVYTVIAPKIGVRKTKDATLSAEPLWDSATPEVGSLGSSCDPVSPVSNDETTP
QPSRHVSAIDMKPLSDTEVESGSGIATGHLSQQRPASAGSAQPSPTIQRTISETLGNMSI
SGEESPVLNETLSVIDEHITNFSTPRHSIATQENHSVHDSSSEYSSYPDHRMSYIRGEET
DEEEEQIPSEAQVRKWDHRQMARHLREIGVDPKHCDIFETQEISGDVLLDMDQEFIYMRE
FDFGVMGRRLKTWHKIRAFQEEIQGPRHLRKASSHGPEDYDRSQTKSVMSGSYLPRIPSL
SERHHHNPRSSRDRSTVKYRDTSYGTQASAPPLSQPHDADATTRPSADSIRRSNHHRYSS
IENTSVFPLADSSAFSASRKAPAPPHEKKPSFDRGWTMNAPLTAHSSSNGQRPSSSLAAT
KQFYKTESNKTDDSSNGFGDSPDIDRGYFSGGDVEGQKQRRVLRKRNSSKRSYSHSRHSS
LAAVADDKKKRHTRFGSTGSMRDLTSLKPLYPKTHSQDITNSALELLEDESHSPTVTNLE
TTPESPTGFLSSIVGYGKSHEASGRSSPLPSTSSLKAITPKVRRTIGLRAISDAVTGSEK
TRISSPIPSSGRDLPQSPTRTDSSTPSGTGTSRSLEMDSMESSRLEGLAVMKNGNGSQRS
KSKKDTSAYRRGLEKKTPKEQMKDADYYGWMKKKSSNLMTTWKPRLFILKGRRLSYYYSE
DDTEERGLIDISSHRVFRADQDAITSLHATLTRTKPLPTTASNTDIQHEEAEPDEKTGSS
RRNSSAESPFIFKLVPPKAGISRAVQFTKPAIHFFQVDNIQQGRLWMAAIMKATIERDLN
LPVKTTNKQKTITLKQARLIAQSSPTPPLDSTSRPPKPEEESSRNTSTSNSATLATTAET
STTDFQKIDIDTGSTSLCPDSVSVDQTQPSVK
Download sequence
Identical sequences F2PI59
TEQG_00667T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]