SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_01154T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_01154T0
Domain Number 1 Region: 421-488,518-567
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000602
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TEQG_01154T0
Sequence length 583
Sequence
MDYTYIPPLSQGSIQMFPPVNNKQTIDYMMRRSSFNSRPLSEATEIQDLDYEVEYSEPES
PRRSIESFGTDSATTLSLSDEPPTPGPYEARTFELPSRNSKQLLPKPHKCSKGENCSKYQ
KRQRKLARIAKQFPNEFALIDGELVATTNQVVPPTPAMTQISRKSDAAPSLVASSDVLGP
GLLPDLHPELQLNAENLNGVRPRDPQENVRQFLTFQHMHSPDLNSASTNQPLEMFPPLPS
QEPPIHVSNQLRSLPKLTIPNQTQSVSDPTSALRTVTPSMGARVVNSPTATQEYNPYAFD
DNNTYRHGTPFSEMDVPITAVPVEPLAREASQSVPPGMRYGNIPTRQHQTPEPPVRSRST
RPERHRRHPSVNTMTPLHEIENLSPIENPSDMDAATKPQPPVTHQTGSTGSSSSSSAQKD
PDVTHSGWMKKRRTTRLLRHEWQDAHFTLKGTILAMHKDEFDTHRHSRALESIDVDDYAV
ACSSLASNSKLTAAFKRSVLRKAANLNNNSYKGMDETAFAFSLIPATKPSERKSIFTANG
KNHHFAVKTRDERINWMRELMLAKALKKGKEAGNKIKMNGNFI
Download sequence
Identical sequences F2PJP7
TEQG_01154T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]