SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_01378T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_01378T0
Domain Number 1 Region: 944-1012,1072-1116
Classification Level Classification E-value
Superfamily PH domain-like 0.000015
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Weak hits

Sequence:  TEQG_01378T0
Domain Number - Region: 673-724,797-817,849-889
Classification Level Classification E-value
Superfamily PH domain-like 0.000795
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TEQG_01378T0
Sequence length 1130
Sequence
MTAVVRDGEMDSTGPPSEQPVPTVSRQSRSHDTLECGSFTAQKLKHGSPDHLHVTNRRFF
IGPLPKGWGQNRRRHWYKSCLGIRDYSSRNQTFSADISAGYQRQSTRFMGPSSTTRFKPS
FPQPDDVEAEVEDQDEEQDEDQDQEGRIQQQHSTTENGQTAGGSQIGPRVIRSIDAGREA
QRRDEDTAYFGLSHPNIKRIQNQERPKNSPLATNSSLVVRMSSDDNVPEAYFTAPDTEPQ
SATPEVNPMPQDNTKSQDRKSTESGQLQSSSSLPYRNSYATTGTSGISTTDGQGLETDVG
SLSSLIPHNKPPPLSTPRDRRQPKPQRLELRPQEPRGEADQTEAELAESQQPSKLINRVI
SDRVRFGVEERIGNGQRRLQNHLGLSDDSRTNRKQKRQARRHGEVLRAEKMLVRIDVTAQ
TVPNLYNDNASLKIETRPVENWREYLVVCRQGYDEQTPYLLQFYKTRVIPQVQGAKVKRK
YAHEVKLSQGQANVNLFSTLDKTVVVWHPTKMDGTRIFIMRARAAAHSVEWYTFIRKVLG
WKQPSSLFVHAPDLDVSLVLQNPFERFAKDNYDENEGTLLNSMGEEQAVSTGIIRTCMDT
LAECSEWSQILDIWKKSEKMGLAWRRYDRIEWIQGGNEERMYGTMAMRTSHDLELRPKRH
YPTSTAVEPSEPLMEEPSPIEGFLILLTSQQGTHRRWGKNFSKRLYFYSEDQYLCFCKPT
KASTPPAPKRPNVPEAESSTAPETISGTPVMYKVDPYPIENGQISWLRNGGNKSYARYCD
EAAYTENRRNTNNLSQAEGYFNLCRVTEIRTVSEMENGGTQRNGTNFGTQHPVTNRATTG
NSSHSDSNQVFELELDDGLVVRLRAYNTETRDAWIHRLRQLTTYWKARVKADINILKSIR
QRNLEKLDIDEEQESVIGQFAQKWEVARADASPELFNVCGPSGCRAIKISGHLYRKPRRR
GSFSKCSVILVEGQLLIFQGSVRTLSGEQVPHTHQSRQTILDLRDCYLYSGIITSSDLLY
HSQTFDNNHPSHNSTPRIYPSDGWTSADEDTATTFVIWNNTRRVLFHGEEERDGNQKTRR
WRHVSRLGASGRSIVFKARSRAERDLWVLAIETEIDRLQQQEDMRIVPEK
Download sequence
Identical sequences F2PKC2
TEQG_01378T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]