SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_01972T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_01972T0
Domain Number 1 Region: 482-639
Classification Level Classification E-value
Superfamily Sec7 domain 1.31e-46
Family Sec7 domain 0.00018
Further Details:      
 
Domain Number 2 Region: 762-801,831-891
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000532
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TEQG_01972T0
Sequence length 1392
Sequence
MWRRSNTTTITTTSTTTATETVTAIRMPWPLRGSSKDTAKKYVSPAHSEVELPPRQSEHS
IRSRPRSPLPRLSETQTVTGERSLLSNDYNNGSRLDSAWEKDDKDPALSRAATKRNRFSL
MRFRHASDPQLSSSYQNSEPPPVPKLIPPPTIITTSPTNHNLEQPVKGLPPSQPHGQLHF
SRSSHNLVSDAEIASRSSSPGLTGRPKKDRSANSTPPASSNAKHSHICFEEAGRLSTTSL
RSGHRAHAHADSQSGLSNARLSESSRSDASSGDRSMYFGQPSKKEPTSASSSIFRFPRLK
KSRASLFPVPIKLPPADGQAYHRQTQSSKSAELFSDSNLPSPSHSSSGRPASTAGSPRPP
LFRKDSATSGRSKSSVSPSATDRAKRRARSSTLGSLHQIQDDTDISLTPDVTPPATSAPR
KSFSDLFNIHSRLKHSQHDLTMTPRSGTPTASTPGAGPSPMTPTASKPNSFSLARELSSY
PPRSPSDTSATYLSRLESSVHRGAIASILSQSAEEFYSVALRKYMRSFSFFGDPMDIAIR
KLLMEAELPRETQHIDRMIQSFANRYHECNPGIFESTEQAYFIAFSLLILHTDVFNKNNK
RKMQRADYVKNTRGEGVAEEVLECFYDNICYTPFIHVEDEINLSSRLSSPKARNNLMAKM
ASTDHLMKSSKDPIDPYALILEGRVSSLRPNLKNVMELEDVYSSTPATSTHLPSPPSIAQ
LNNTFDNPCKLQIVSARSRPDAFMTESTIANPAESQPGLVDIRVVKVGLLWRKDAKKKKA
LSPWQEWGAVLTGSQLYLFRDVQWVKSLISQYDAKCKQDSRPPAVTFTPPLTAFKPDTIM
STAEAVALLDSSYKRHKHGFLLVRHGGFEEVFLANSDAEMAEWVNLINYAATYRTSGIRM
RGSEKAKQSNADPQYTQEAHAARRAQIAAHIKESNEKLFVAQRQVDMLLRNARHLQHLAP
IHPRTRGQVILAAGRMSVKVKWARLDLERLKCHRGILARDLAEEEGRVGAVGWKKEVGLA
LGQMMDGAGDIGENSTLSGEKDSERVSISTTSAPNGNGLVGSEAASISADSNRHSMSSTI
ASKQTNFSTPNPNSVTTPITDTGSTSNTVTPRPSVTDDDDEEQRFLRETGILALDTVSLS
SPPNSPGMQEPITPISTNSTNKDAVQPSPPPSSERSKVRRSFQRTLREAHHNVPLHRTSR
KGRDRDSSNSAQSSTQSTSVNASTSNGNNPGTPSTPAATSDEPGTLPRKSPSFTVHGKKA
SIITFGSEWQTLSPEQRLKQRKPQSNQQLHAAQGQPDGSTAGVDDGTDSVIASSIVSTIG
PESADQTGTQIARSTSIASTSALTSKSTDTGAPAVPSRCSPAISDVSHTPGSGSGNTSEH
QVTHDDSKLVVA
Download sequence
Identical sequences F2PM16
TEQG_01972T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]