SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_02098T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_02098T0
Domain Number 1 Region: 115-372
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-47
Family SSRP1-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TEQG_02098T0
Sequence length 463
Sequence
MGFITVNEAAIDKAFKANPALQGRILEAISEYPQCVGLFEDIARFICSEREAHQSQLHSA
YSIAPATESLQQQHITPVEGPAAKKRKVANGFAGSAASGAMGGEDSALIAGIQGDADLQL
YVQDLSFTIPQRKKLRLEFTQDLGGGNEYIRARNQASGEVEFGVPVGKIEHVLCLPVPEK
AQRQFNFCIIPEYKDGITSAPDGVITFEPMVWTVPDAPPRGAYLGSGTPVSESASLAETY
QTYFQSFLDGKLKHVKVLCPDEKEFVSATPEAHRKSEKAYHVKAFRGSKEGYLFFLASGI
FFGFKKPVLFIAFENVESISYTAVLQRTFNLNITTRSAAKPDEMQELEFSMIDQADYPGI
DAYIKKHGLQDASLAEERRAKRLNINAPRGGDGADDGSGANDEGVPQAEEEESELQKAQR
ELENQQADEEDEEEDDYDPGSEGESEGSGSSSEEEEDENTQGA
Download sequence
Identical sequences F2PMG4
TEQG_02098T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]