SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_03044T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_03044T0
Domain Number 1 Region: 968-1188
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-43
Family DBL homology domain (DH-domain) 0.00087
Further Details:      
 
Domain Number 2 Region: 1208-1267,1329-1377
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000326
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TEQG_03044T0
Sequence length 1817
Sequence
MSDQENRPPRAYPPLSAAVSHGQSQPHVHHGQQGTAVQAPSYASQYPTGPHLASQKPPPP
HAQMQRSPSYQAGDDTGYFDSRAAAAVGGGGGAGAGSAAYPYHDGRGGSLHGSHSSNFGS
RHSQHSTVSQTSSHGSSAMSGYQHQYQGPNTPSPGQQQPSYNPQQFSQQQQQQQPPTPQQ
AGYNPQVFSQFSSQQPHHQPYNPAAYQSSPSVGSFQSSPAGNWSAGTPVQTSYPSTSPSF
FPPSHAVPTSPGPMSARPLETYSDYSLPYGNNTTHHHPTYPPMPSQSVAATPVSAHPSSY
SSYNYPSSNHSQSTISYGTEATNDRIRRYSSAKPPAQTLDYQYMPNPPAHGSVHHDAGYR
ISTRHASYPASPPPPPPPAHQNSQSTSPRRTDTLTRHPQARPLPGPPTESEGRNGREQVE
PSYDDIIKQVEAAVMEGRPDTTRRHSSRARRPLPQQPPIQESDDGAYPTSAVSPGVQLLP
DEVQTHTNGGNISSTGTGQYVNYNAYSDDSDAEVAAGLEALRVADEEEAAMRARRNTHTS
TTSSFGYQHQEPPPPPPPPQNQHHHHGESSSDSDFALHDIGLYGGGYSADMHYGEDALMH
GVRTSSQPDGRGSTPNQYDYPSIDQDSIHPFPEIEPTARVDTVGTGGLSEPSAYRRMSFE
NGDEAALRRPSSATSSLSDLPGEGEPQDLFFHPGMSARPLPPPPVPVTTQNLLPHLMPAG
TYRSSEHTGQIPLDQYHMPPYPTSPDTYSYSNSTPAVPRSTSLSDHTNTHKSADAIIRSK
TDADRAKSKQAAYDSSMSTPSVTLDLPVLPAGKRKKFHPGKLSSEQFRKCTEPWAISAIV
AWIRDLAEDEADLKEHSIVDAIVALLTHKVPTMNTADAETLSDRVVKSMFAAGALIKDEE
WVKFGPGTLSGVLWQITGQGCYSSRLHNQEYDIFGRCYSHHCMRTLKKINLKMVEAQKKA
EDWATFYKVGKEVFANHSKKEIDRQNNLHEIVTTEDSYIAQLDVLRTLYRDTLATAQPSV
INPKRLDRFLRDVFGKVDAVKRVNEEYLLAQLKYRQKEQGPFIVGFSDIFREWIRKAKAA
YIEYAATFPNANYLVRREAESNMLFRSFLNQARENRLSNRLSWDTYLKAPITRIQRYTLL
LNTVYKNMEKDSEEKSNLLQAIEEIKLVALDCDNKVGEMTKKMDLKELGAKLQLRPEMKS
IVELNLEHLGREIIHQGDLQRPRTKRFNWVDIRAILFDYYLVLAKIVIHRDAAGIKHEMF
DVSKLPIPMDLLTLVSTNDDPVVRSTVKGIAPANPRAGAPAGLAHAATAPQISSPTPGAA
GRSVTTTVLENSRDEKILYPFRIKHLGKRDVYVLYAPTAQSRQEWCEKIYEAKTKHAAAL
YAQNAEPFRLRVLSDSAFAYSDQAVPPKSAVIKGTPLDRAIREVEKKYERNLSRPLPVCR
AAVNCATVFQQPPGKMMCAIGTDYGVYISAYDDPRGWTKGISMLRVTQVAVFEEFNLFLL
ISDKSLIGYHLDSICPVNGAVQPDSQRRAPQKLSGNREVGFFAAGRMKDRALVFYKKRDG
ISSTFKVLEPVLQKSSSSRSRFLSRRGQTEFFREYDEFYIPAESYGINLFHTSLAIATSR
GVEVLTLDKKQPWSVPNLKSEQADVQSHLTGIANRVKDLRPLGMFRLSDSEFLVAFQECA
VYVNKHGDVSRSVVMEFVGIAHSACLCGKFLLLFNEDFVEVRNAMNGRLRQVIAGRNVTL
LDDGGNGNSGIDQHTNAVGGSNFNEAASTPAGMGRNGLGISTGFGTVYRTVKICMQHPER
ERSQIVLELLENEGQKD
Download sequence
Identical sequences F2PQ43
TEQG_03044T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]