SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_03482T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_03482T0
Domain Number 1 Region: 388-487
Classification Level Classification E-value
Superfamily PH domain-like 0.000000301
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TEQG_03482T0
Sequence length 881
Sequence
MASADAPHLHLHPLHAPQKLARYRSVRASHPSASHPASHPVSNASASTAQNASISRSMSR
YRKTTHGVPPPPLPLPAQLDSYDFTSYNDHHYDDGGNDDDDDDDDDDDNGHNVVSGPASR
RVSMQNNTARPLTGAAAAGAAARRSLDRNSAKRHSSYSQQHQQQYFDGRDSYDRPSRSSG
PYFVVEPGMGPNTFDQSYGITPAQTTTTTTTTTTTSTSTKKSKGKLLKEKGGGLLGRLKG
EDRLRKKDKKMAVDGYNTTGNAASNAANITRSGAGVDAPVSAVNAGERKVTVTCNEAFIS
LPVTPSTQAQDLICSAANCLAKDIVPEAAIIVEYEHVRDVLNSWNSDSQNTLKIIPDPDP
NIIQALLAKSAPRRQPPDVSFSLYHCQRTGKWDRRWVTLRMDGQVTVSKKQGSTDCTNIC
HISDFDIYTPTRREYKRLKPPKPLCFAIKSQQKSAMFLSTENFVHYFCTKHEEVGGAWHN
AVQEWRSWYLVHVMGEGATRKKKQPDAPPPAEPAAAAAAADDTPYQLRSFQSLSINDPNI
EEAYNKLTGKRSRPTSFSHQTGNPAVPAAPLVNQAVNKEPIKPKRTKSKSKKKTAAAAAA
DDSLSEEQPFAPTGLLGRTYTQRHKAMLDREKEQQHAQADEGPFISTGLLSNMRHHQGPT
SPVSNHYPDQQYQHYHPSRSNTTSAAAAAAAADPRPTTTTTSSRSKSTRHPPKPLIDLTP
TYKEPPQHARKGRGVTPIQGLPLVESATGPDLHPNAIVVPPSTTWRKPRTSDPSPNLHPN
PSISRHRSRQNTTGAAPLVDLNAVDPVDQNHGYGHMAMPGSFPFAPTGLVAQSQKLAASQ
GAAKGGRGVATGDRKKAGKPLLDMSHVPLPAHYQHPQADSD
Download sequence
Identical sequences TEQG_03482T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]