SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_04336T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_04336T0
Domain Number 1 Region: 1640-1918
Classification Level Classification E-value
Superfamily BEACH domain 3.66e-109
Family BEACH domain 0.0000000892
Further Details:      
 
Domain Number 2 Region: 1938-2230
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.09e-28
Family WD40-repeat 0.0051
Further Details:      
 
Domain Number 3 Region: 1477-1605
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-23
Family PreBEACH PH-like domain 0.021
Further Details:      
 
Domain Number 4 Region: 225-347,568-588,666-729,794-814,857-898
Classification Level Classification E-value
Superfamily ARM repeat 0.000000453
Family Plakophilin 1 helical region 0.068
Further Details:      
 
Weak hits

Sequence:  TEQG_04336T0
Domain Number - Region: 705-815,858-921,1097-1228
Classification Level Classification E-value
Superfamily ARM repeat 0.0288
Family MIF4G domain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TEQG_04336T0
Sequence length 2234
Sequence
MSGAQPRSRVSSSAISVERLTPKLQPAIDGLATCCHNPPGSIEEASGATEHLLLIHHTLI
DDHQPQEAKSLFRQLGGFENVLGLLEHLAELYKPDTFGDADGKLLLSIVKDSLCIVAESL
KDDPGNKRYFGKRDNAAGIIVYERILSSLAVKLNNTQDVELLYGGLLAAGLGNETMSQFF
STVRKKAEDAESNTLLSLSELVNRTLGTGEVVENPEFFGPLLRLWLAQTAEQETYPILRL
SVPLCLTRLASLSQRNCLALHSTGILSPLLTLVTVPERSKDELEAYLKLATILCQHGINS
LQDAIQLYQKAQKVPQASRFLLDALKSSKSPPCVSSSKWSLASAILFDEAFNDDLIAVLC
HLGPRYYGNFQDCLGSFQTYRASATLNLRNESLHAGKEDQSDIVSVIRQKGSILIPESSV
LLNISPTSVMDDDDTNNIDESQLVKSLSKTAGKNLTQLTRIKGNSIVINGAVPAINEALT
QPHGVAILTGDPVVIVPQSLDDDNWRNSEAMEKENGYGILAMLLREKLGFPSPVQSSPLK
TSPVCSTTQERNEASMELLLPILRFVGSELFAWRVITTGVVKRLIEALKAEIFTTTTLKL
FVAAFKSLVGACVTAEVLRSVSLFITFSIHSAKQRVNNKTNKNKNTRLDIRSRRPGNLYP
DHVPGYVSKEQIGVEILRVFTEVFCNSEDTASIQKFARTVTNKWLLYLLSEDNPDVVILV
TMILSRLFIVHGTAYTKKFAEKAGGFVVMRHRLKRWWNLAPLWPLCFSILFGLDPGLINL
DKNSGASDLQRLLSSPETLKVSFPEVLPVITGMLQLGLKASVMPRSGSPSSHAEDDDGVA
DSGSSSLRSEVSTPGPISSDHDILKAVVDFLAHIHEKSQNFRDFTVTSNYVEELLRALYP
VVVGSDIVNAGFELESNSEGLRFGGDSVTIQPLQGPRPIVRTSTVEGTDAQDNDNELHRS
SSFILVSPNKSKYSPSPARLQQIVTPVPDAASPRPSNPVANDILDILLAVYTDQLFGRKE
FPGLQLFARIPPGFVEHQIYFESWILKNLLAHLEGKISKDKKVLIEPRVLNNLSRLLSYV
TEAVYGGWFIDGAMATLNFIGPVLEYLQEPDIASLKSVRLCSQTIASIRSTVFRTVLLRL
SAAEGQNAYTFLQQLTYWQTVLLSHEESPNEQLQLIYYLLYSKIVTEKEDVRVAAAGLWR
ITLVQKPSETSAILGQATPSLHRRLSLGFQKLVGMDDDSFLHWIDDQRDDLDCFFFGALC
KGWESFVRDENTKTQETARIRASKRKDKLKQWTQTESINEEILRKHGITFGHWTANISVS
EGLKHQRAVQDQQDDFNFMASAFSRMYTNLRRENGFLATQSKHNWRLDQTEGRSRMRLRV
TPDDSTAKRDYQPKRKATNDTPEIKLDIRTRPAPNSDMINLSPPTIVPDSVDTESLDNEA
EDKSATEDSFELIDEPTGNDPYEDKNRKVMKNLQRGDQVQYVCNISRIIGLEACEGLLIL
GKISLYIMDNFFQRSDCEIVHVSQAHPEERDPYVRVISGRESDDRKHNNGAHRSRSWIWA
DVVSVSKRQFLFRDVALEIFFSDGRSYLFTLISAKLRNELYNELTSRAPQIHSSTSSTED
SWRFETLRSEGNNSQFFGSKLVNVFSQMPSHPATRKWLKGEMSNFHYLMLVNTLAGRTFN
DLTQYPVFPWILADYTSEELDLTNPRTFRDLSKPMGCQTITREADFRSRYQSFAEMGGEN
APPFHYGTHYSSAMIGGTFDHADRLFFSIPDAWNSASRLNMTDVRELIPEFFYLPEFLSN
SNNYDFGIRQSTGQPIDSVELPPWAKGDPKIFIAKHREALESPFVTRNLHQWIDLIFGAK
QRGEAALEAVNVFHHLSYRGAKDLDSIEDPMERLATIGIIHNFGQTPHQVFHKHHPGREE
IQNKPIRLDTSADSLTRLPFTLLDIQERVSSLSFSVKQDRLLCAAAFRLNIPPTYDKYME
WGFSDGSIRFYAAESRKLIGHFEHVHIGQLSCATFADSQTLITAGTDCTIAVWSFTSTSR
SVDLLPKASLFGHRSPVTVLAVSRSFSTILSASKDGQVMLWDLNRLEFLRELSTGPPVSC
ARINDVTGNIAVCRSNMVCLYTLNGTLLLERPVCEHSDDNVLSCAFYEGVGNEWLERELF
FTGHRKGLVNIWSKCIRNGVFELGLIRQLHHVNTSRGDGAAALAGITCVLPLSHVVYTGD
ESGQVYEWNCVQRH
Download sequence
Identical sequences TEQG_04336T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]