SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_04435T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_04435T0
Domain Number 1 Region: 138-258
Classification Level Classification E-value
Superfamily PH domain-like 0.000000632
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TEQG_04435T0
Sequence length 1282
Sequence
MGRLRVPSFLSSRPDGPKGKTAAASVSFSTPDLPGAVTQTPSNQPPAAGAGPAPDQEQQT
SASPFMRRTRRLSRPIASLWTQKSAQSENEDRNQNQNLSQSQSQSESQTAPSSPPFDAEP
LVVPELEPVFAYLNNQANKLYQEGYFLKLNDLDTQGQACPDRQWVECFGQLVGTVLSIWN
ASALDTAGGQANASPSFINLADATIKMMETLPTNNETNQPLQNVVSISTAGKNRYLLHFD
SLHSLTQWTAAMRLTVFENSLLHESYTGALIAGKGKYLNGIKLILEKTTFKYEDWARVRF
GAGTPWRRCWCVISPPGEKEMQLYNRSLKKKSAYDRAPTPPKGNIKFYETRKTSKKVAPI
ATISDAYSAYAIYPQARPLVDQSTLVKVEGLVTIGENTSDGFVFVLPEMHNAVSGFETMI
RWLFPAYDAFRLYGRPNRLLADTVSPNSLMFAMPSNKRRGYLDILDVSALIHTQGSENWS
AREWRKQLKDATSRRMTSNAGSSRTSSVSGRRSGKRSSLPQRTGTVRFGSATVGPRNGEP
NSSSDTVASNSPTKPGISHTRSESENTGLPSARRGRRSPPFFENNIGEDIPEHPPAPPPE
LPQTDGPSEVDGTDSRSSPDSGAYMDNTRPADRLDIIQSLEPNPPPQGVPVSPAFSHDPR
GTPQFKPQPSPEIGHAANRMSVGTLDQLVDMNKKNGNSHGLAVAGATAAWNAATDNSKET
DNGTGQRADPRGPTLNRLNSIGASSSNYSQGSPITPSDTTSNVNVGVNINITDTPTEGQF
PVKQQNGTQNPPLHKPIARKPVAAEIPIAETASVRTASTLGSLRDNIDMDALDRIIRRPR
SPSPPPPPQPKYTFKQETAVQDDASSIVAPSYASSHKSSPSVRSIQSVQKPRMGKMKVVG
DAMPKTDDLVIGDARYKHPAVTPVEVSSDIPEVDFGPTHTYKPTARRPGTSDTMLLLSSS
HQRNPSEGTLATRGRRLSTGRLLEHLNQESNESPSPPPPTQERGRRRSVLWQPGMVQDSG
PVTPGPTSISAEQFVHDRASRSQIHLPVMPTRATPPPPRPASGDWSAYIRHQSSATHLPQ
RPHSRGPSVMLDMPARPSSRGANTILDVPARPSSRGASVILGPLDAPARPSSRGANRMLS
QPDISGHLSAREQEHVARVTGSSFLNLNNNQSPQFGSGLVSTIDARERERKAMKDGFSGQ
AVQQAIAQRQYQAQVQAQAQAQAQAQAQFQLQQQFQQPLGTSPGYAASMQFPYLPQQQPQ
QPPQAGYYAPPQGQQWQPQYHA
Download sequence
Identical sequences F2PTR1
TEQG_04435T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]