SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_04609T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_04609T0
Domain Number 1 Region: 105-243
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-48
Family Ran-binding domain 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TEQG_04609T0
Sequence length 250
Sequence
MADEQKTDPTTTAPPEAVTEDKKEETTATEKTGEDESKKAEAEGEKADKPAAAEESKPAT
TDSVFSMFGGGPPKEKKEQEDDADEPSGSSKKKTEGDDEDPEAEPDVHFEPVIRLTEKVE
IKTNEELEEQTFKMRAKLFRFDRESKEWKERGTGDIKLLKHKENHKTRLLMRRDKTLKVC
ANHYVVPDMKLSPNVGSDRSWVWNAAADVSEGEPEAQTLAIRFANSENAALFKEAFEKAQ
EENALLFGKD
Download sequence
Identical sequences A0A059IZ14 F2PUN2 F2RYH4
TESG_03821T0 TEQG_04609T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]