SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_04635T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_04635T0
Domain Number 1 Region: 662-855
Classification Level Classification E-value
Superfamily Sec7 domain 3.01e-60
Family Sec7 domain 0.0000128
Further Details:      
 
Domain Number 2 Region: 386-507,565-584,714-727,885-957,1009-1035,1155-1273,1374-1469
Classification Level Classification E-value
Superfamily ARM repeat 0.00000001
Family Armadillo repeat 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TEQG_04635T0
Sequence length 1607
Sequence
MSLELQRDNNDGQHTLHNQPLEQPTSSPLRGARINRDRNMVPLRAAAPIAINPIALVTTE
CIAVTSAMRKHARWAHSSVAAILGGGVSSRSMDRDTSIPLGTGNISLGSKPAQNHSASKS
GTPDAEGDYSLAGRWGLRGRRGKSIQDNPLMSAFTRLRIDLKDCKDIRLFDTPCLLHPFL
QVIRSSSTSAPITSLALSAITKFFAYNIINHDSPRLSVALQLLSAAITHCRFEASDSAAD
EIVLLRILKLMEGMLSRPEGELLGDESVCEMMETGLSMCCQVRLSEVLRRSAEMSMVNMC
QIIFQRLARLDVDSEQPEGGAGNADTEETLRNLKMDPSVDGETVASQHASSLGTDTTNPE
KEERVSGDSLTTIPTLEGVNPAVQADSYEDIEKIAPYGLPSIRELFRVLIDLLDPHNPQH
TDAMRVMSLRIIDVALEVSGPSIARHPSLAQLAKDDLCRHLFQLIRSDNIVILNSSLRVA
GTLLATCRRVLKLQQELFLSYLVACLHPRVEIPKEEGIDPSLYAGVPRAPKLVKPSPSQA
GSGRSTPVPVKDRQKLGMEGGSRKPEAREAMVESIGALVRIPNFMAELFMNYDCDVDQAD
LCEDMVGLLSRNAFPDSATWSTTNVPPLCLDALLGYVQFLADRLDQEPPSTADTDLKRLR
SQREKKKIIIQGTAKFNEKPKAGIAFLASKGIIQNPDDPLAVAKFLKGTTRVSKKELGDF
LSHRSNEALLDAFIGLQDFKGKNVVEALRELLGSLRLPGEAPLIARIVTVFSEKYLDAVH
PEEIADKDSLFVLTYAIILLNTDMYNPNIKPQNKMSYEGFARNLRGVNNGKDFSTEYLQD
IYSSIRNSEIILPDEHENKQAFDFAWKELLVKAKTAGNLSLCETNAFDADMFEATWQPVI
ATLSYVFMSASDDAVFSRVVIGFDQCAQIAAKYKLKDVMDRIIYCLSSISTLASATPSNT
SLNTEIQAGKKSVMVSELAVRLGRDFRAQLATAVLFRVIVGNEAIIQQNGWEHIIQILHN
LFINSLIPQFDSFFKVLDMPPIPLQPPSQVIDRDNRENDTSLLSAFTSYLSSYAADDPPE
PSDEELENTLCTVDCINACDIAQLFNNLKVMPLDSVVIFVESLLSELPDTGAAVIVVKPE
RPAPNPHRSEGSKVDKNKPAYKPGVLYILELSTVLTLRDTGTIERLGDKLTSVLQDIVRD
AKNIHPLTLSRAVYYLLTLLRHSYCINESEALKNELSMSPDFWSILQRLHQHQEAAQMAF
ELLQSIVESTVPVITADNYEAAVNLLNDFATAGGIATVREIKREMALRRPKPVRQVRVRD
NPYVIRGTKAIGVIYRVTGRIPALIQHSHLEKNEAWAAYWSPIFNSLTTQGLNPCRDIRN
QTMSALQRSLLSSELASTDHTKWVTIFKKVLFPLILELLKPEVYQSDPLGMSETRVQAAT
LLCKIFLHYLVLLSEWGEGMLDLWLRILDILDRMMNSGQGDSLEEAVPESLKNILLVMAN
GGYLVAPPNNDPGKERIWTETQKRLDRFLPNLFGEIFPTTPADAPSSRHGGSRTMRPEAK
QQGNSDSVDSKDKSVDMPEDTGSTADTEKAKVGQAEPTAAEPGDEVE
Download sequence
Identical sequences TEQG_04635T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]