SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_05675T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_05675T0
Domain Number 1 Region: 510-648
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-26
Family Ran-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TEQG_05675T0
Sequence length 650
Sequence
MAAPDSLRQENGALKGLHLPLPLFRPHPAPFSSPRGSCEGSASRDIWAARALHNDMRACY
WSNYRPDNTHGQSPPQHKSKEDVDPDTGDYSEGTKSSTLPSDPPERSTEFTREKVCSDTH
KDGGGERPVRQKLKETSIAGTGTANPDQTSEQTKMGEENGELPEGNKTDTNTTERGRLKK
KRSLDDLMNDDGQSGHYEESGHRRKRSRDSKMETTPERETGPEAPTAELEKVKSPKKKRS
RDQFDKDLDSKVGEDNAKENDDSTADPSKENAELESLGASPNSRTDKGEPEKKRHRDNSQ
DRHTEEPKDTTAASKSALPNPFSNTSATSPFGSLGASKQSPTKTGEQSTKEQSTNPSAFA
ASKLAAFSGSETSPFGAIGGGASIFKSKPGTKSEEDGKTSSTGSGASPFAAAASGPSPFG
ASFSGSAFANSSFASGFAAAAPKPGERLTSFASPKPTNFGSTTKPKAFGSKEEKKDDDDE
EGEDDSEGDEEKGETFQGLEEEKEDTRFFKQETETGEEDEETHFSVRGKLFHFTGSEWKE
RGIGTFKLNVKKLPESAAGDEEEGGAAATKPTKRSARFIMRTDGVFRLILNIPLYKGMKV
GDAEGKEPTGKHVQIAGVEDGRTVPLLLRTSNADAAKDLHAAAQEILHQM
Download sequence
Identical sequences TEQG_05675T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]