SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TEQG_07637T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_07637T0
Domain Number 1 Region: 671-866
Classification Level Classification E-value
Superfamily Sec7 domain 1.83e-71
Family Sec7 domain 0.00000536
Further Details:      
 
Domain Number 2 Region: 411-510,593-611,1131-1545,1741-1827
Classification Level Classification E-value
Superfamily ARM repeat 1.15e-18
Family Mo25 protein 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TEQG_07637T0
Sequence length 1864
Sequence
MADSEERPPEAVQQPEAHAEPDTTTADETVVAEESQPPQEDTVEDEAGPPEGEEQPEPED
GAEEDDDATGTDAHDGAGAEGGVDNATLRGSEQTPSVVIEQSRSRSDSRSTVATQSGQQR
STPLSSALITYSYFAFPSVPDGSQSADQPPLIERAIETICDCFENEHTAIEIQQQITKSL
LAAVLNDKIVVHGAGLLKAVRQIYNIFIYSKSAQNQQIAQGSLTQMIGTVYDRVRTRLDL
KEVRIQETETRETRNGSTVDSPPNAAEDGAVTDVEGQSDIGSSNVVDQPVAKEPTEKLTL
QSFETNKDDTMVNDSAPTMVTRAKVVRKTSKSGEEIDPAADEEDEIYIKDAFLVFRALCK
LSHKVLTHEQQQDLKAQNMRSKLLSLHLMQHLLNNHIAVFTSPIATIRHGSNSDESMTLL
QAIKPHLCLSLSRNGASSVPRVFDVCCEIFWLMVKHMRVMLKKELEVFFKEIYLAILEKR
SSPIFQKQSFMHILERLSGDPRALVEIYLNYDCDRTALENLFQGIIEQLSRMSSMPVTVT
ASQQQQYEQQHSKAPSTPNDWHNRGTLPPSLTTAKIDQTPPPTNNQHYPPEYAMKQNALE
CLVEILRSLDIWSSQDSEPKSLGRGLMSRSSVDVSRDSMDTSQGGPIIPSPRVDNADSDT
GASSPVPEDDPNEIEKVKQRKIALTNAIRTFNFKPKRGMKILLSEGFIPSNSPTDIAHFI
FRNDRLDKATLGEYLGEGDAENIAVMHAFVDCMDFTKRRFPDALRDFLQSFRLPGESQKI
DRFMLKFAQRYVTQNPNAFASADAAYVLAYSVILLNTDLHSTKMKGRRMTKDDFIKNNKG
INDNADLPVEYLSGIYDEILNNEIVLRTERETAANLGQLSAPQPGLASRAGQALATVGRD
IQGEKYAQASEEISSKTEQLYRSLIRAQRKSAMKEALSRFIPATSVRHVGSMFNVTWMSF
LSGLSAQVQDTQNRETIRLCMDGIRLAIRISCMFDLETPRVAFVTALAKFTNLGNLREMA
AKNVEALKVLLDVAITEGDHLQSSWREILTCISQLDRFQLLTDGVDEGSLPDVSRASPST
DSRSQKSLQVPKKPRPRSGNGLASFRKDVAIESRSAEMVRGVDMIFTNTANLKQEALVDF
VRALNAVSWQEIQSSGQSESPRTYSLQKLVEISYYNMTRVRIEWSKIWEVLGEHFNHVGC
NANTAVVFFALDSLRQLSMRFMEIEELPGFKFQKDFLKPFEHVMANSTAVNVKDMVLRCL
IQMIQARGDNIRSGWKTMFRVFSVAASEPYEGIVNMAFEHVTQIYKTRFGVVVSQGAFAD
LVVCLTEFSKNLKFQKKSLQAIETLKSTIPKMLKTPECPLSHRRTNSGSSQGEVVAQAAG
QSPEEQFWYPLLIAFQDVLMTGDDLEVRSRALTYLFETLIRYGGDFPPAFWDVLWRQLLY
PIFIVLQSKSEMSKVPNHEELSVWLSTTMIQALRNMITLFTHYFDSLEYMLDRFLGLLTL
CICQENDTIARIGSNCLQQLILQNVNKFTPEHWEKIVGAFVELFERTTAYELFTAATTAP
GMPPERRNIEEATSQADPGSPSAKPDRSQESARPSEDGDETHQAQLPAASSELEDYRPQP
DLQQPPTVVTAARRRFFNRIIINCVLQILMIETVNELFSNDAVYSQIPSKELLRLMALLK
KSYQFAKKFNGAKDLRLKLWKQGFMKQPPNLLNQESGSAATYINILFRMYHDEREERKNS
RSETEDALIPLCADIIRRYVQLDEESQQRNITAWRPVVVDVVEGYTGFPLETFEKYIETF
YPITVDLLSRDLNVEIRLAIQALLRRVGECRLGITPQTPITSPTSPRNSTSHSHFNGRRP
SVGR
Download sequence
Identical sequences F2Q3G0
TEQG_07637T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]