SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SOCG_02308T0 from Schizosaccharomyces octosporus yFS286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SOCG_02308T0
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-85
Family Inorganic pyrophosphatase 0.000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SOCG_02308T0
Sequence length 284
Comment | SOCG_02308 | Schizosaccharomyces octosporus yFS286 ultracontig inorganic pyrophosphatase (285 aa)
Sequence
MSSSRALTNFLTRFKGKPHTPEFRAYCYNKEKPVSFLHDVPLFSKEGTLNMVVEIPRWTQ
AKCEISNTIPFNPIVHDMKNEKIRYVQNCFPYHGYIWNYGAFPQTFEDPNKLDAHTNLKG
DGDPIDVCEIGEAIGHLGEIKQVKVLGALALLDQNETDWKILTIDVNNPMANSLNDIDDV
KKLMPRLLTCTRDWFAVYKLPDGKPRNVFGLSGEFLPKSIAMEIINECHASWKTGSQRAD
YINSFQENSEKATRITQAVDEMQESQLPKSFAFPSSGYYYQLPE
Download sequence
Identical sequences S9Q0J1
XP_013016255.1.790 SOCG_02308T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]