SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SOCG_04364T0 from Schizosaccharomyces octosporus yFS286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SOCG_04364T0
Domain Number 1 Region: 4-284
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-107
Family Inorganic pyrophosphatase 0.00000000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SOCG_04364T0
Sequence length 289
Comment | SOCG_04364 | Schizosaccharomyces octosporus yFS286 ultracontig inorganic pyrophosphatase (290 aa)
Sequence
MSEYSTRQVGALNTLDYQLYIEKNGSPVSAWHDVPLYANAEKTVLNMIVEIPRWSQGKLE
ITKDATLNPIKQDTKKGKLRYVRNCFPHHGYIWNYGAFPQTFEDPNVVHPETKAKGDSDP
LDVCEIGEARGYSGQIKQVKVLGVMALLDEGETDWKVIVIDVNDPLAPKLNDIEDVERHM
PGLIRATNEWFRIYKIPDGKPENSFAFSGECKNSKYAEEVVRECNEAWERLVNGKTDAKS
EFALANTTVSGSVSHDAAVAQTIPAANELPPAPVDPSVHKWFYISGSPL
Download sequence
Identical sequences S9PRL7
XP_013020660.1.790 SOCG_04364T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]