SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Asptu1|46414|fgenesh1_kg.7_#_472_#_Locus8662v1rpkm9.33 from Aspergillus tubingensis v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Asptu1|46414|fgenesh1_kg.7_#_472_#_Locus8662v1rpkm9.33
Domain Number 1 Region: 172-251
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000576
Family Coronavirus S2 glycoprotein 0.0081
Further Details:      
 
Weak hits

Sequence:  jgi|Asptu1|46414|fgenesh1_kg.7_#_472_#_Locus8662v1rpkm9.33
Domain Number - Region: 319-357,578-614
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.085
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Asptu1|46414|fgenesh1_kg.7_#_472_#_Locus8662v1rpkm9.33
Sequence length 739
Sequence
MLFSKSGRTIFPLLPPYGVQDPNGVQGRVIPVHPDGSTPYLGLRARLSQVWLNRWTVLLL
LVLARVLMAASSIKTDMNRAKSEALSACTSVESMGDAMVSMPHYLAEGVNELTADGVNAA
IDGLKTLLMLTLTGVEELVIFFVKVMYQTYLCLFTLVVHGVVDVGLSLIEDVTDVLNSTV
KTVAKDIAKVTETFEDDYNEVISKINGVASLFGGSVPTLNITSEIDKLENVQLPSSIDKD
LQKINDSIPNFNEVMNFTENVIRFPFDEVKKLVNESLGNYTFNASALPVPAKKTLTFCDK
NDGINSFFAGATDIILTARKIFIAVLVVAAIIACVPMAWQEIRRWHTMKERSQLVRKEAH
DPMDVVYIVSRPHTAAMGIKAASRFSNSRRQILVRWVIAYATSPAALFVLLLALAGLLSC
LCQYILLSAVKRTVPELSNEVGDFAEEVVSVLQNTSAQWANDANKVIINVDDELNDHVFG
WVNTSTGALNDTLNTFVNKTIGVLNDTFGGTLLYEPLLDVFDCLIGLKVESVQKGLTWVS
DHAHIDFPLLPNDTFSRGAADSLNSSDASDSFLADAGDETSNKITEVVYKVISALEKALL
IEVIIASCILLVWVINAMFGILRALTLFWGRDKNRGEGGPAPPHSRPNPGSGSDTNGFID
VPLTTLPSHRDSEETAARSQPAPRYEVATSQGSSAAVVSSDSEYPDEKVGFAGQRNALRV
DGVSDLRGSSYVEYGMEKY
Download sequence
Identical sequences A0A1L9MVR8
jgi|Asptu1|46414|fgenesh1_kg.7_#_472_#_Locus8662v1rpkm9.33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]