SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Asptu1|119504|e_gw1.3.648.1 from Aspergillus tubingensis v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Asptu1|119504|e_gw1.3.648.1
Domain Number 1 Region: 275-361
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000178
Family Ras-binding domain, RBD 0.022
Further Details:      
 
Domain Number 2 Region: 391-494
Classification Level Classification E-value
Superfamily PH domain-like 0.000000916
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Asptu1|119504|e_gw1.3.648.1
Sequence length 817
Sequence
MAMEKQDHQVVAGQHPTPMKFSRYRSVRKAAAKQPPPPPPQSYPLPPPLPIPPVASAPPS
HDQPALPNGSSNGSSSVQRSMSRYRRRAPTAQSADADAQPPVPAPPPAYKAQVEPSANGG
PVHPHFQDSEGAEMVRMRNKLASKLAAREKRHQEKPEDDEAERERHRQNAMDRLTGGEAK
SVSITHSKPASRDRSADKVEEYAVRRPHKESEHRKPQTGSASASRRASMEPRRQSVGDAA
NPAHRRSVHGDASAVPAIDTTVPAQFPGIDAPVSAVNARERRVLVQYRKSSARICITPST
SAQDIVATALEQMDAGVDPEKFILMESFAELGLERPLRRYEYVREVLNSWTHDEQNTLIV
VPAASLDALTLLDARNVSLGPPADVTYYMYYSQRPRKWDKRYVTLRSDGQVTVSKKENAQ
DATNACHLSDFDIYSPTASYLANNVKPPKKFCQAVKSQQKSNMFLSTENFVHFFSTNDRE
IADGWYRAVQTWRSWYLVTKLGAGQPAEAEAMQPDEAPFKPLLNPFEEPANEVKPSQPAL
ERAKSTKTKELFSHKKSTRERGPPPTSFPKLLTGDSDLATGSSSDEAPFSASGLLGRTYT
MRQRALKEREEQEKRDNEELIKQGLIGTMGSRHPSRTNTMTSNHGPDPNLMRRTQSMKNK
PLVDLTPVYQEPPQHIRKGRGIAVEPGLPLIDAATGPEAPGGIQIPSATTWRRPQVPPEP
PMPEVRTRNRSNTARSINNQQRYHHTAPTTPTDGENLRSQDGPFIPNSLLARSTPHQNIQ
GSPVGHGVATGDRNAAKPMLDMSPDNPFAEGSLLRGL
Download sequence
Identical sequences A0A1L9N8Q5
jgi|Asptu1|119504|e_gw1.3.648.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]