SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Asptu1|196447|gm1.10638_g from Aspergillus tubingensis v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Asptu1|196447|gm1.10638_g
Domain Number 1 Region: 1124-1146
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000484
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 2 Region: 511-574
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000445
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Asptu1|196447|gm1.10638_g
Sequence length 1149
Sequence
MPGLHRAPVDPGSLPPEYWNSFEPLYTNPDPPHQHSHPSQPPQLQQIQPAPPQQQHATPM
GISWDHPMFSQTPQTRSPLPTPQEQNHGIYTSATPQSWRTTPLQSQQIIHSTPQTFSMNQ
QYRQAQFPHAQPAFDSQPLPSSDNSHFQSYTFPRGYYPPQNLSVPDVFPQSHSPRPAQAQ
AQPTQYRSDSHQHQVPQYSLPAGYPEGNTHIPINFAAGYGQSTPTVSEQTINPQFLNSPQ
QAASQQASLQNNLLYMNPADFERPEDPKLYSFFRDDLQVPQILGQGQGQGQPQPQHTPQP
QPRPQPIARTQPIAPTTQYEFIVPLNGQDTVTPVAPVKATKPKKQPSVKKQPQPKKPTMK
GGSKKLDGQSASSSESDSSDESDLEIEEPEEVSPLPPTRPSEPEAAARYDALKAVWSPRN
RHPNVDKVKSALVAFKDVVKAVRDSWKESSQAMKVAENKGDNDKAAQLKKNVVLQRRLMD
VVVSTTQEQGHPTIVEKLGEHPMAVAALYSFLLDRHQASDIDGTLTVNILKLLSRFVTMD
EDVLQKTNVAKLLPRFVKKGGPAVKELAQKIMDNAAASTKRKLEAGKSASKDGSPKPSVA
DEPVPDGRGGEGTGSKRPREGEGNGQPATKRMVVPAHPKPAAKPNSTVVSGVSKRPQEVG
QDSKPAAANAARPKANIIAPKPTSLFGSLSSASKRPGTSNAERAAAAAAAKASNPAEKKE
PPPPRPTFSFGDLMADLNKQKDPAPVQPAEDRPPETEEERKKRLRKEARRKLRVTWKPDA
SLTEVRLFTHDPEEELGPGDHLGDVKGEGSVLKLHRDLDELEEEDDGGIREEQLFDYYEP
SEIDNGDIAPDDRARNYIKRGGTAEPTSPEKSAQEHREATTLMVFYTSPADVPSTPKEPP
PAEAEDTAPEVVSFGELPDHVKARQDRYFAMVNPKPAPAPQSAPNAPFDISNLLKIIQSA
PQQQSTPPLAQPQVAQAPMSDLERTFSMFRQQQQQQPPPPPQAPLLQMPQFPPASQPQAA
QGVDFQGLLSIFNAQKQMQPAPIVPQVQPSQPSIAPNLAAIISQLTSQNQSAAANGHPPP
GHYEDPERKRIRETGGYDGNDDERFNSKRSRSNEPNKKHPKAGLVPCRYWREGKCRKGDE
CTFRHDPLD
Download sequence
Identical sequences A0A1L9NG46
jgi|Asptu1|196447|gm1.10638_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]