SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000011 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000011
Domain Number 1 Region: 247-477
Classification Level Classification E-value
Superfamily RNI-like 1.96e-38
Family Cyclin A/CDK2-associated p19, Skp2 0.0068
Further Details:      
 
Domain Number 2 Region: 63-262
Classification Level Classification E-value
Superfamily RNI-like 9.42e-16
Family Cyclin A/CDK2-associated p19, Skp2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000011   Gene: ENSOGAG00000000012   Transcript: ENSOGAT00000000012
Sequence length 495
Comment pep:known_by_projection scaffold:OtoGar3:GL873670.1:1760371:1775581:1 gene:ENSOGAG00000000012 transcript:ENSOGAT00000000012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQGRRRQGCDGGVAAPGDAHIYSELPAPVRSERSLPCESGLVLCSPECPSFAIKSLGLRG
ISCISLTDLDGSPTSQQVLQSVAHHMGPHLQSLCLGGGSPTEASFVALVLGCPVLRILDL
SGCNSLFTSGKLLSQPEMAQSVRRALSGLRELNLAGLRDLADLSFNQLSSCTPSLERLSL
AYCHLTFELGPAQGSIGPQDSSPSQFSFRNLLRFVKERAGRLHALDLSGTGLPPEALQAL
GQVTGLQLQELSLHSCRELSTEAVATLCRQQPGLTSLDLSGCSELTDGALLAVSRGLRHL
RCLSLGKLRRLTDAGCAALGGLHELQNLNMAECCLVSGKELAQALGSMHRAPSRLVSLSL
AFCSSLKVLQFPQLRQLSLSLLPALTDMGLVAVARGCPSLERLALSHCTCLSDEGWAQAA
SSWPRLQHLNLSSCSQLTEQTLDTIGQVCKQLRVLDVAMCSGINMAAVRRFQAQLPQVTC
IQSRFVGGADLTLTL
Download sequence
Identical sequences H0WFJ5
ENSOGAP00000000011 ENSOGAP00000000011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]