SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000039 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000039
Domain Number 1 Region: 286-353
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-16
Family HLH, helix-loop-helix DNA-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000039   Gene: ENSOGAG00000000043   Transcript: ENSOGAT00000000043
Sequence length 505
Comment pep:known_by_projection scaffold:OtoGar3:GL873534.1:17118302:17213018:-1 gene:ENSOGAG00000000043 transcript:ENSOGAT00000000043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALRVQMFMPCSFESLCLSSAEHPGASKPPISSSSMTSRILLRQQLMREQMQEQERREQ
QQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQTHLENPTKYHIQQAQR
QQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCDKEGF
YKFEEQNRAESECPGMNAHSRASCMQHLLVDLVGDQCFGERQYNFSVRSIHPELDIYNTL
PVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTESEARALAKERQKKDNHNLIER
RRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELENRQKKL
EHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCNQDLLQHHAD
LTCTTTLDLTDGTITFNNSLGPGTEGSQAYGVPTKMGSKLEDILMDDTLSPVGVTDPLLS
SVSPGASKTSSRRSSMSMEEAEHPC
Download sequence
Identical sequences H0WFM0
ENSOGAP00000000039 ENSOGAP00000000039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]