SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000041 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000041
Domain Number 1 Region: 1262-1376
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-34
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 
Domain Number 2 Region: 1065-1243
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-19
Family DBL homology domain (DH-domain) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000041   Gene: ENSOGAG00000000045   Transcript: ENSOGAT00000000045
Sequence length 1517
Comment pep:known_by_projection scaffold:OtoGar3:GL873795.1:734914:755610:-1 gene:ENSOGAG00000000045 transcript:ENSOGAT00000000045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLA
KVQQEACAQYSGFLFFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLA
LKCLAPGGGRVQELPVPNEACAYLFTPEWLQGINKDRPTGRLSTCLLSAPSGIQRLPWAE
LICPRFVHKEGLMVGHGPSTLTPELPSGPPGLPSPPLPEEALGTRSPGDGHNAPAEGPEG
EYVELLEVTLPMRGTPTDAEGSSGLSRTQTVPTRKGAGGKGRHRRHRAWMHHKGLGPRDQ
DGARPPGEGSSTGASPGSPLGAEALPEAVLKVSEPPTEALGEASDSCPLRTGEVGVGAGQ
GAEGPPGTPRRTGKGNRRKKRAAGRGALSRGGDSTPLSPGDKEETSHQEALVNLPSSHEH
ELPECSLFKEEHEGSGKPESEPKEELEPADEKESQPPEACRSTEEGAGEREQERPSLECI
AGHIGPEGLLSDPPTTPLETVPEEREDSIPKEAPSASISDDPDVAWDLMASGFLILTGGV
DQSGRALLTITPPSAPEEPLPSRDMLSTALHYLHSLLRPDLRVLGLSVLLDLRKSPPLPP
ALLPVLSQLQDSGDPPLIQRLLILTHHDLPTELCGFQGAELLSENDLKRVAKPEELQWDL
GGHRDLSPSYWVEIHQEVVRLCRLCRGVLGSVQQAIKELERAVEPEGEEVEGMPEPLQKV
LADPRLTALQRDGGAILMKLRSTHSSKLEGPGPATLYQEVDEAIHQLVRLSNLHVQQQEQ
RQRLHRLQQVLQWLSGPGEDQLASFAVPGDTLSALQETELRFRAFSTEVQERLAQAQEAL
ALKEDAASQKVLDIFEHRLEQVESGLHRALRLQRFFQQVHEWVDEGFARLAGAGPGREAV
LAALALRRAPEPSAGTFQEMRALALDLGSPAALREWGRCRARCQELERRIQQQLGEEASP
RGHRRRRADSASSGGAQRGPHSPSPSLSSLLLPGSPGPRAAPSHCSLAPCGEDYEEEGPE
LAPEADGRPPRAVLIRGLEVTSTEVVDRTCSPREHVLLGRAGGPDGPWGVGTPRMERKRS
ISAQQRLVSELIACEQEYVATLSEPVPPPGPELTPELRGTWAAALSARERLRSFHRTHFL
RELQGCATHPLRIGACFLRHGDQFSLYAQYVKHRHKLENGLAALSPPTKGSLEAGPYLPR
ALQQPLEQLARYGRLLEDLLREAGPEPSSERQALGAAVQLLREQEARGRDLLAVEAVRGC
EIDLKEQGQLLHRDPFTVICGRKKCLRHVFLFEHLLLFSKLKGPEGGSETFVFKQAFKTA
DMGLTENIGDSGLCFELWFRRRRAREAYTLQATSPEIKLKWTSSIAQLLWRQAAHNKELR
VQQMVSMGIGNKPFLDIKALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSPGAC
SLPARVEEEAWDLDVKQISLAPETLDSSGDVSPGPRNSPSLQPPHPGSSTPTLASGGILG
LSRQTHARALSDPTTPL
Download sequence
Identical sequences H0WFM2
ENSOGAP00000000041 ENSOGAP00000000041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]