SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000108 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000108
Domain Number 1 Region: 150-467
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.55e-121
Family Transglutaminase core 0.0000000106
Further Details:      
 
Domain Number 2 Region: 4-148
Classification Level Classification E-value
Superfamily E set domains 1.26e-43
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 611-707
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.8e-22
Family Transglutaminase, two C-terminal domains 0.00069
Further Details:      
 
Domain Number 4 Region: 490-569
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000249
Family Transglutaminase, two C-terminal domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000108   Gene: ENSOGAG00000000124   Transcript: ENSOGAT00000000124
Sequence length 711
Comment pep:known_by_projection scaffold:OtoGar3:GL873569.1:9990738:10008362:-1 gene:ENSOGAG00000000124 transcript:ENSOGAT00000000124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLVAALELRSIDLQSPRNNKEHHTKEMGLRRLILRRGQLFTIQLGFSRPFQPQTDTITF
VAETDTGPEPSELLGTRAVFSLSQTWHASVWGASDYTTDSSSLQVSIFTPANAVIGHYTL
KIATSQGQGHSVTYPLGTFILLFNPWSTEDDVYLPSEMLLQEYIMRDYGFIYNGHERFIT
SRPWNFGQFEDDIVDICFEILNKSLYYLKNPSQDCSRRNDVVYVCRVVSAMINSNDDNGV
LQGNWSEDYSRGVNPLEWNGSVAILRQWSARGGQPVKYGQCWVFASVMCTVMRCLGVPTR
VVSNFRSAHNVDRNLTIDTYYDQNAEMLPTRKQDKIWNFHVWNECWMIRKDLPPGYNGWQ
VLDPTPQQTSSGLFCCGPASVKAIKEGEVHLPYDTPFVYAEVNADEVIWLFRGGQAQEIL
AHNTSSIGKAISIKMVGSDQRQDITSSYKYSEGSPEERSVFMKASRKMLGPKRTSSPFLD
LLGSGDLVAQPVQLQLHLARTPEWGQDLLLTLLIRRVPHRAHPQGPLRLVVRFCAQALLH
GGGTHGPLWRHMMQLNLDSGKGQRQKKLVTGRWNRRDRRKVSSDARVAGEAITQAYKTSA
LLLYSFEPQELSFHVSERAEVGKALRVHITLTNTLTVALSNCMMVLEGSGLIDGQIANDL
GTLVAGHTIQIQLDLYPIKEGPRQLQVLITSNEVKEIKGYRDILVAPARVS
Download sequence
Identical sequences H0WFS6
ENSOGAP00000000108 ENSOGAP00000000108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]