SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000224 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000224
Domain Number 1 Region: 32-116
Classification Level Classification E-value
Superfamily F-box domain 5.49e-17
Family F-box domain 0.0044
Further Details:      
 
Domain Number 2 Region: 98-256,332-391
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000373
Family 28-residue LRR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000224   Gene: ENSOGAG00000000250   Transcript: ENSOGAT00000000250
Sequence length 428
Comment pep:known_by_projection scaffold:OtoGar3:GL873555.1:9208461:9225979:1 gene:ENSOGAG00000000250 transcript:ENSOGAT00000000250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGGGDSDHDSSGEDTAEKSKKLRTTNEHSQTCDWGNLLQDIILQIFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDIVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
Download sequence
Identical sequences H0WG16
ENSOGAP00000000224 ENSOGAP00000000224 XP_003789784.2.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]