SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000361 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000361
Domain Number 1 Region: 21-298
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.11e-90
Family (Glycosyl)asparaginase 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000361   Gene: ENSOGAG00000000405   Transcript: ENSOGAT00000000406
Sequence length 312
Comment pep:known_by_projection scaffold:OtoGar3:GL873659.1:3968863:3993940:-1 gene:ENSOGAG00000000405 transcript:ENSOGAT00000000406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVDMSLVVVVHGGGASSISKDRKERVRQGVSKAATVGYNILKQGGSAVDAVEGAVVTLED
DPEFNAGCGSVLNANGEVEMDASIMNGKDLSAGAVSAVRCIANPIKLARLVMEKTPHCFL
TDQGAAKFAATMGIPEIPGEQLVTEKSKKHLEKDKNEKGAQKAECQKNLGTVGAVALDCK
GNVAYATSTGGITNKMVGRVGDTPCIAGSGGYADNAIGAISTTGHGESILKVNLARLTLF
HLEQGKSLEEAANLSLDYMKSRLKGLGGLILINKTGDWVVKWTSASMPWAAAKDDKLHSG
LDVDETTITDLP
Download sequence
Identical sequences H0WGC4
ENSOGAP00000000361 ENSOGAP00000000361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]