SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000510 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000510
Domain Number 1 Region: 64-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000510   Gene: ENSOGAG00000000570   Transcript: ENSOGAT00000000570
Sequence length 228
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:11203714:11263270:-1 gene:ENSOGAG00000000570 transcript:ENSOGAT00000000570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERVRMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSG
SSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLE
EAERKSQHQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVD
VESTEFSHGEVDNISTTSISDIDDHSSLQSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences A0A2K6FYH3 H0WGQ1 Q642D1
ENSRNOP00000040770 ENSOGAP00000000510 ENSRNOP00000046701 10116.ENSRNOP00000046701 NP_037292.2.100692 NP_037292.2.4139 XP_003787227.1.62490 XP_004659412.1.11716 XP_012626531.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]