SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000529 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000529
Domain Number 1 Region: 20-169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.22e-33
Family Dual specificity phosphatase-like 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000000529
Domain Number - Region: 182-250
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0785
Family Formin homology 2 domain (FH2 domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000529   Gene: ENSOGAG00000000590   Transcript: ENSOGAT00000000591
Sequence length 338
Comment pep:novel scaffold:OtoGar3:GL873535.1:29532464:29540208:-1 gene:ENSOGAG00000000590 transcript:ENSOGAT00000000591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEAQGPSGSSDCRSPRASEVSYAGQMLEVLPQVYLGGAAAVSEPDHLRAAGISAVLTVD
SEEPSFQVGTEVEGLRRLFVPALDRPDTDLLSHLDRCVAFISKARDEGRAVLVHCHAGVS
RSVAVVTAFVMKTNLVTFEEAYGHLQSVKPDAKMNEGFERQLKLYQAMGYEVDTSSAIYK
QYRLQVVTEKYPELQNIPQELFAVDPATTLEGSNDKVLYKCRKCRRSLFRSSSILDHNEG
SGPEAFVHKRMTLPFMVSIGPRCTSYFIEPVQWMEFSLLGVMDGQLLCPKCRAKLGSFNW
CGEQCSCGRWITPAFQIHKNRVDEIKALPVLGSQTRTI
Download sequence
Identical sequences H0WGR9
ENSOGAP00000000529 ENSOGAP00000000529 XP_012658146.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]