SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000566 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000566
Domain Number 1 Region: 131-293
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-26
Family Voltage-gated potassium channels 0.0027
Further Details:      
 
Domain Number 2 Region: 310-427
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000354
Family Potassium channel NAD-binding domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000566   Gene: ENSOGAG00000000629   Transcript: ENSOGAT00000000630
Sequence length 1104
Comment pep:known_by_projection scaffold:OtoGar3:GL873784.1:905333:1174144:-1 gene:ENSOGAG00000000629 transcript:ENSOGAT00000000630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVQVEFYMNENTFKERLKLFFIKNQRSSLRIRLFNFSLKLLSCLLYIIRVLLESPSQGNE
WSHIFWVNRSLPLWGLQVSVALISLFETILLGYLSYKGNIWEQILRIPFILEIINAVPFI
ISIFWPSLRNLFVPVFLNCWLAKHALENMINDLHRAIQRTQSAMFNQVLILISTLLCLIF
TCICGIQHLERIGKKLNLFDSLYFCIVTFSTVGFGDVTPETWSSKLFVVAMICVALVVLP
IQFEQLAYLWMERQKSGGNYSRHRAQTEKHVVLCVSSLKIDLLMDFLNEFYAHPRLQDYY
VVILCPTEMDVQVRRVLQIPMWSQRVIYLQGSALKDQDLLRAKMDDAEACFILSSRCEVD
RTSSDHQTILRAWAVKDFAPNCPLYVQILKPENKFHIKFADHVVCEEEFKYAMLALNCIC
PATSTLITLLVHTSRGQEGQQSPEQWQKMYGRCSGNEVYHIVLEESTFFAEYEGKSFTYA
SFHAHKKFGVCLIGVRREDNKNILLNPGPRYIMNSTDICFYINITKEENSAFKNQDQQRK
SNVSGSFYHGPSRLPVHSIIASMGTVAIDLQDTSCRSASGATLSLPTEGSKEIRRPSIAP
VLEVADTSSIQTCDLLSDQSEDETTPDEEISSNLEYAKGYPPYSPYIGSSPTFCHLLHEK
VPFCCLRLDKSCQHNYYEDAKAYGFKNKLIIVAAETAGNGLYNFIVPLRAYYRPKKELNP
IVLLLDNPPDMHFLDAICWFPMVYYMVGSIDNLDDLLKCGVTFAANMVVVDKESTMSAEE
DYMADAKTIVNVQTLFRLFSSLSIITELTHPANMRFMQFRAKDCYSLALSKLEKKERERG
SNLAFMFRLPFAAGRVFSISMLDTLLYQSFVKDYMISITRLLLGLDTTPGSGFLCSMKIT
EDDLWIRTYARLYQKLCSSTGDVPIGIYRTESQKLTTSESQISISVEEWEDTKDSKEQGH
HRSNHRNSTSSDQSDHPLLRRKSMQWARRLSRKGPKHSGKTAEKITQQRLNLYRRSERQE
LAELVKNRMKHLGLSTVGYDEMNDHQSTLSYILINPSPDTRIEVNDVVYLIRPDPLAYLP
NSEPSRRNSICNVSGQDSREETQL
Download sequence
Identical sequences H0WGV0
ENSOGAP00000000566 ENSOGAP00000000566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]