SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000597 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000597
Domain Number 1 Region: 542-741
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-35
Family DBL homology domain (DH-domain) 0.0000059
Further Details:      
 
Domain Number 2 Region: 754-880
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-25
Family Pleckstrin-homology domain (PH domain) 0.00025
Further Details:      
 
Domain Number 3 Region: 238-342
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000929
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 4 Region: 31-112
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000811
Family CRAL/TRIO domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000597   Gene: ENSOGAG00000000662   Transcript: ENSOGAT00000000663
Sequence length 1035
Comment pep:known_by_projection scaffold:OtoGar3:GL873685.1:2309708:2474376:-1 gene:ENSOGAG00000000662 transcript:ENSOGAT00000000663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTYSLTLPTLCSAEAASIGFIIVIDRRRDKWSSIKASLTRIAVAFPGNLQLVFILRPSCF
IQRTFTDIGIKYYREEFKMKVPIILLNSVSDLHGYIDKSQLTQELGGTLEYRHSQWINHR
TAMENFALTLKASAQMLQTFGACLASIELPRGMSSTEDLLMSHRRQRDKLQNELKLLGKQ
GATLLSCIQEPAVINPAGKLNPNELENVVTMERLLVQLDETEKAFSQFWFEHHEKLNQCL
QLQHFEHNFCKVKLALDNLLEEQAEFTGIGGSVTHVEQLLKEHKKLEEKGQESLEKAQLL
ALAGDQLIQSHHYAVDSIRPRCVELRHLCDDFINENKKKYDILGKSLELHRQLDKVSRWC
EAGIYLLASQPVDKCQSREGVDIALNDIETFLSTAKEYQLPSPKEFYNQFELILTLDVEA
KAQKVLQKLGDVQEIFHKRQVSLMKLAAKQTRPVQPVAPHPESSPKWVSSKTSQPSTSVP
PAPPLRASEEPRVERDLSSLEKEGDETKSEVKNEEVLESSHNRESSELEPRASRGDLFPS
RSLIRDLLQTEEIYIKEIKSIIDGYIIPMDFIWLKHLIPDVLQNNKDFLFGNIRELYEFH
NRTFLKELEKCAENPELLAHCFLKRKEDLQIYFKYHKNLPRARAIWQECQDCAYFGVCQR
QLDHNLPLFKYLRGPSRRLIKYQMLLKGLLDFESPEDLKIEPGDQEGGSTKNGPKRTKDS
PFSAELQQALAVIEDLIKSCELAVDLAAVTGCPDDIGKLGKMLMHGAFNVWTIHKDRYKM
KDFIRFKPSQRQIYLFERGIVFCKIHTEPGDQGLSPCYSFKKSMKLMTLSIHQVGRGSNK
KFEIASRNGLEKYILQAASKEIRDCWFSEISKLLMEQQNNVKANQRTQFTFSSSEAMGQH
SPSWSPQGDRGTSSHPTAARSFPFSPQGSSSSDFISTETFEASDGAEDLEKENSALSLAG
LFQSDDSDETCPSTRVLQEPGENAQRKGSAEETNFRASSGTKEQASGSPGVLALAGDTAG
PRAEAVPARAGYRRT
Download sequence
Identical sequences H0WGX8
ENSOGAP00000000597 ENSOGAP00000000597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]