SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000639 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000639
Domain Number 1 Region: 33-91
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-21
Family Fibronectin type II module 0.0024
Further Details:      
 
Domain Number 2 Region: 152-197
Classification Level Classification E-value
Superfamily Kringle-like 1.74e-16
Family Fibronectin type II module 0.0018
Further Details:      
 
Domain Number 3 Region: 2-45
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000157
Family Fibronectin type II module 0.0027
Further Details:      
 
Domain Number 4 Region: 92-143
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000343
Family Fibronectin type II module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000639   Gene: ENSOGAG00000000714   Transcript: ENSOGAT00000000715
Sequence length 197
Comment pep:known_by_projection scaffold:OtoGar3:GL873836.1:299105:306541:-1 gene:ENSOGAG00000000714 transcript:ENSOGAT00000000715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETCVFPFTYKGSIYFTCTKTNSLSHWCATRAVYDGRWKYCTTEDYPRCVFPFLYRGKSYN
SCITEGSLLGRLWCSVTSSFDEKQQWKFCETNEYGGNSFSKPCIFPSTYRNNVIFECLED
ESNKLWCPTTENMDKDGKWSLCADTRISSLVPGFPCHFPFNYKNKNYYNCTSKGSKENLM
WCATSYNYDQDHTWVYC
Download sequence
Identical sequences H0WH14
ENSOGAP00000000639 ENSOGAP00000000639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]