SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000666 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000666
Domain Number 1 Region: 1061-1272
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-52
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 1738-1978
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000989
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 1264-1356
Classification Level Classification E-value
Superfamily PH domain-like 0.000000246
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000666   Gene: ENSOGAG00000000744   Transcript: ENSOGAT00000000747
Sequence length 2063
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:28985044:29040841:-1 gene:ENSOGAG00000000744 transcript:ENSOGAT00000000747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGAPRPPLYRSVSFKLLERWSGGPGPREEDTDTPGLQRRASRRPNTAVPGQPSRRVSK
LASGPPAASAQPRPLRSLSPSVRQLSRRFDAPRLEEDYAGARDGGIFPGTAEEAAESAAR
GAWPSVTEMRKLFGGPGSRRPSADSEGPGTPSPDGAAWELLARDPRQPPTPPPRTCFPLA
GLRSARPLTGPGTEGRRRRQQQQQQERAQRPADGLHSWHSFSQPQAGARASCSSSSSITS
YPVSRSRAASSSEEEEEGPPQPPGAQSPAYHGGHSSGSDEDQDGEGGHRWEGRPGLRPGS
SLLDRDCRPDSDGLNLGSMDSARGGRSPEPLTSPRAPREEGLQELGPLPCAPGPQEGLLP
MSDTVGGAFRVAKVSFPAYLASPAGSRGSSRYSSTETLKDDDLWCSRGSGGWGVYRSPSF
GTGEGLLLRPQARTRTKGLAGTTRPSRDGGLELGKNRQRKSLSNPDIASETLTLLSFLRS
DLSELRVRKPSGSPGDHGSSTLDGRGSPSARDPVGQLESIPAPVPAAAGTRPTLKDLTAT
LRRAKSFTCSEKPTAHRLPRASALKSSSSELLLAGPGAEEDPLPLIVQDQYVQEARQVFE
KIQRMGAQQDDGSDVPPGSSDWAGDMTQGQRSQEELSGPESSLTDEGIGADHEPPVTAFC
GLHTTGVWRPLSSSSAQTNHHGPGTEDSLGGWPLVSSETPPTPGALRRRRKVPPSGPGGT
ELNNGEAGEAYRSLSDPIPQRHWAATSEGPSGFSMDSNLLGSLSPKTGLPVSPAVDEGLT
SGHSDWSVGSEESKGYQEVIQSIVQGPGALGCVVDDRVAGKAPKKKSLSDPSRRGELAGP
GFEGPGGEPIREVEPMLPPSSSEPILAEQRAEPEEPSPARGRAKSERALPEALPTSSTAH
QDFHLDPKLANILSPRLTRRGSKKRPARSSHQEVRREESNQDQTGCLSTARPSSKHVRHA
SVPATFMPIVVPEPPTSVGPPVAVPEPMGFPARAHPMLLAPSLEDVTKQYMLTLHSGDVP
APAPVDMPCLNLVAPPSAEAKPPEAARLPGEATPASKGCSKPQVDMRKHVTMTLLDTEQS
YVESLRTLLQGYMQPLKQPENSLLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCVQTWHA
QQKVGALLLQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQ
ALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLDAQRNIKQVAERINKGVRSAEE
AERHARVLQEIEAHIEGMEDLQAPLRRFLRQEMVTEVKAIGGKKDRSLFLFSDLIVCTTL
KRKSGSLRRSSMSLYTAASVIDIASKYKMLWKLPLEDADIIKGASQATNRENIQKAINRL
DEDLTTLGQMSKLSESLGFPHQSLDDVLRDLSAAMHRDLSEKQALCYALSFPPTKLELCA
TRPEGTDSFIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFS
CAAPTLNSCPEPSPEVWVCNSDGYVGQVCLLSLRGEPDVEACIAVCSARILCIGAVPGLQ
RHCHREQPGSLRGPRETAAEPAGPELDVETAADEEAATLVEPGPQPCLHISIAGSGLDIV
PGPTEGDPRPELVPFDSDSDDESSPSPSGTLQSQASRSTISSSFGNEETPSSKEATAETT
SSEEEQEPGFLPLSSSFGPGGPCGSSPVDGRALRRSSRGSFTRGSLEDLLSVDPEAYQSS
VWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQREA
GHFWDPQNFKSVTLGAQGSPITKMVSVGGRLWCGYQNRILVLNPDTLQLEHTFHIGQDSG
RSVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAA
CLRITALLVCEELLWVGTSAGVVLTMPTSPGTVNCPRAPLSPAGLGQGHTGHVRFLAAVQ
LPDGFNLLCPTPPPPPDTGPEKLPSLEHRDSPRHRSPTSARPKMLVISGGDGYEDFRLSS
GGGSSSETVGRDDSTNHLLLWRV
Download sequence
Identical sequences H0WH37
XP_003780965.1.62490 ENSOGAP00000000666 ENSOGAP00000000666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]