SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000685 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000685
Domain Number 1 Region: 227-478
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.03e-57
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 7-39,92-162
Classification Level Classification E-value
Superfamily POZ domain 4.89e-28
Family Tetramerization domain of potassium channels 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000685   Gene: ENSOGAG00000000768   Transcript: ENSOGAT00000000769
Sequence length 640
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:42356490:42587278:1 gene:ENSOGAG00000000768 transcript:ENSOGAT00000000769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKIQSNERVILNVGGTRHETYRSTLKTLPGTRLALLAASEPQGDCLTSTGDKLQQSPPP
LSPPRRAPPLSPGPGGCFEGGAGNCGSHGGGGGGGDHPGGGREFFFDRHPGVFAYVLNYY
RTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGS
ADDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFF
ILVSITTFCLETHEAFNIVKNKTEPVINGTSAVLQYEIETDPALTYVEGVCVVWFTFEFL
VRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI
FKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEH
TQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGM
YYSLAMAKQKLPRKRKKHIPPAPQASSPPFCKTELNTACNSTQADVCPGKDNRLLEHNRS
VLSGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKS
RSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL
Download sequence
Identical sequences H0WH55
ENSOGAP00000000685 XP_003783455.1.62490 ENSOGAP00000000685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]