SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000761 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000761
Domain Number 1 Region: 216-401
Classification Level Classification E-value
Superfamily E set domains 9.33e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000104
Further Details:      
 
Domain Number 2 Region: 107-230
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.35e-18
Family Voltage-gated potassium channels 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000761   Gene: ENSOGAG00000000856   Transcript: ENSOGAT00000000855
Sequence length 439
Comment pep:known_by_projection scaffold:OtoGar3:GL873610.1:839378:868863:1 gene:ENSOGAG00000000856 transcript:ENSOGAT00000000855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRPARPRPRPLDKPLSDPSGFKSPGPACRTAPLLTPARPVGPSVPLPLGPSEGPLHPGPK
MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDDTSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLHDSTVRYGDPEKLKLEES
LREQAEKEGSAISVRISNV
Download sequence
Identical sequences H0WHC2
ENSOGAP00000000761 ENSOGAP00000000761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]