SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000770 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000770
Domain Number 1 Region: 635-822
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-53
Family DBL homology domain (DH-domain) 0.000000177
Further Details:      
 
Domain Number 2 Region: 830-958
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-35
Family Pleckstrin-homology domain (PH domain) 0.00000993
Further Details:      
 
Domain Number 3 Region: 328-465
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000464
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 136-231
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000628
Family CRAL/TRIO domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000770   Gene: ENSOGAG00000000864   Transcript: ENSOGAT00000000865
Sequence length 1065
Comment pep:known_by_projection scaffold:OtoGar3:GL873636.1:2738170:2834905:-1 gene:ENSOGAG00000000864 transcript:ENSOGAT00000000865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPAAPSAPWTSVLCGKNSGLALNPDGYTFVPIAHAIPLQVDMAMALRRARIAEKYGKSY
LCLLRAVFAAETDLFLRVKDISHFLMQDIAFLSGGRGKDNAWIITFPENCNFRCIPEDVI
AKVLTYLTSIARQNGSDSRFTIILDRRLDTWSSLKISLQKISASFPGNLHLVLVLRPTSF
LQRTFTDIGFRFSQEDFMLKLPVVMLSSVSELLTYIDDKQLTPELGGTLQYCHSEWIIFR
NAIENFALTVKEMAQMLQSFGTELAETELPDDIHSIEEILAIRAERYRLLKNDITAVTKE
GKILLTNLEVRDIGEDESSTVESHQITGDWHTINKLLTQVHDMEKAFDGFWEKHQLKMEQ
YLQLWKFEQDFQELVAEIEFLLRQQTDLGDVTGNITQVKQKLKKLENLDENSQDLIAKAR
FVILHGHRLAANHHYALDLICQRCNELRYLTDILINEIKRKRIQLSRTFKMHKLLQQARQ
CCDEGECLLANQEMDKFQSKEDAQKALQDIENFLEMALPFINYDPETLQYEFDVILSPEL
KIQMQTVQLKLENIRSIFENQQAGFRNLTDKHVRPIQFVVPTSENLMRSRTPFFSSKHGK
KDWRQNQNNLKIEVVHDCQEKRSSGQSSSLENDNSLDVLKKYVLNELIQTERVYVRELFT
VLLGYRAEMDNPEMFDLMPPLLRNKKDVLFGNMAEIYEFHNSIFMSSLETCTDAPERVGP
CFLERKDDFQMYAKYCQNKPRSEAIWRKFSECAFFQECQRKLKHRLGLDSYLLKPVQRIT
KYQLLLKELLKYSKESEGTTQLKEALDTMLDLLKAVNDSMHQIAINGYIGNLNELGKMIM
QGGFSVWTGHKKGATKMKDFARFKPMQRHLFLYEKAVVFCKRRVETGEGCDRYPSYSFKH
CLKMDEVGITEHVKGDNRKFEIWYGGKEEVYIVQAPNVEVKMLWLKEIRNILLKQQELMT
VKKQKQQNGLSEQNQLSSQNDEKQQGAIARFEETESEHASGMVEVSEAILAGQAAASAVW
TEMSHSAETLEEPDEWPSNYFYSTYGNEEEDRSLMRPVTDMALLF
Download sequence
Identical sequences H0WHD1
ENSOGAP00000000770 ENSOGAP00000000770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]