SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000786 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000786
Domain Number 1 Region: 4-241
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.92e-51
Family Asparaginyl hydroxylase-like 0.068
Further Details:      
 
Domain Number 2 Region: 957-1061
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000275
Family 28-residue LRR 0.025
Further Details:      
 
Domain Number 3 Region: 826-861
Classification Level Classification E-value
Superfamily F-box domain 0.000000000196
Family F-box domain 0.0061
Further Details:      
 
Domain Number 4 Region: 527-602
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000624
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000786   Gene: ENSOGAG00000000881   Transcript: ENSOGAT00000000881
Sequence length 1085
Comment pep:known_by_projection scaffold:OtoGar3:GL873618.1:1914551:2025206:-1 gene:ENSOGAG00000000881 transcript:ENSOGAT00000000881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSRRLVDVMDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTV
VDLVDWVDNMWPQHLKEKQTEATNAIAEMKYPKVKKYCLMSVKGCFTDFHIDFGGTSVWY
HVFRGGKIFWLIPPTLHNLELYEEWVLSGKQSDIFLGDRVERCQRIELKQGYTFFIPSGW
IHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRVQPKFRYPFYYEMCWYVLERYVY
CVTQRSYLTQEYQRESMLIDSWLEMEEESCEQQPQEEEEEQEEEGEGADKVPKLPVDGPV
SPTSTPSEDQEAPGKKPKAPAMRFLKRTLSNESEESVKSTTMPIDYPKTPTGSPTTEVAA
KWTHLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEHADDDPSLAI
TGVPVVTWPKKTPKKIMFPSLPLVFVTWVQGKRPYVEETLPLECPLRVKLAANRTTAGAR
RRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGE
AGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLKIKESEGVVNDELPNCWECPKCNHAGK
TGKEQKMNRDIKDAGAPTSAPLLRPWGLASPGLSPTLPHWSSNPLPPTLLRHLFPWFPMP
QLRAITCGSGVGPSKLCDRASASWDPSLQEALLLRLLVLPSPATRWRLESPLSSSPSNLA
GNAHRPVFQANSRARTDLNEWLHFSGSVQGGRSIRWEQFDHSPLPFSFFHESSRQSLSIY
QSELKPGKEGQSDQSCLGHSSMVEGQEALGTRGRSAYDGAAHVMHREVWMAVFSYLSHQD
LCVCMRVCRTWNRWSSDPGCTTITDMSVIQPTKASSPLWQMQASSLHAFWVNLSLFSRPW
LVSNLPASMYVAGAITTATGTKLGILFLNVAILILGRSPAVRDKCNPSWFLPGQMDNRSK
LRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLT
EINLSDCNKVTDQCLSFFKRCGNICHIDLRYCKQVTKAGCEQFIAEMSVSVQFGQVEEKL
LQKLS
Download sequence
Identical sequences H0WHE5
ENSOGAP00000000786 ENSOGAP00000000786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]