SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000815 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000815
Domain Number 1 Region: 67-121
Classification Level Classification E-value
Superfamily F-box domain 0.00000768
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000815   Gene: ENSOGAG00000000911   Transcript: ENSOGAT00000000912
Sequence length 310
Comment pep:novel scaffold:OtoGar3:GL873574.1:6158722:6172030:-1 gene:ENSOGAG00000000911 transcript:ENSOGAT00000000912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKSLCGLEASQVPTEEALSGAGEPCDIIDSSDEIDAQEESIHERTVSRKKKSKRHKEDLD
GAGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLDASLPL
RLRPESMEKLRCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLFWCRKIV
GNRQEPMWEFNFKFKKQSPRLKSKCMGGLQPPIQYEDVHTNPDQDCCLLQVTTLNFIFIP
IVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGQKLRSEQGVQVILDPVHSVRLFDWW
HPQYPFSLRA
Download sequence
Identical sequences H0WHG9
ENSOGAP00000000815 ENSOGAP00000000815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]