SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000851 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000851
Domain Number 1 Region: 140-294
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.15e-21
Family Nuclease 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000851   Gene: ENSOGAG00000000951   Transcript: ENSOGAT00000000952
Sequence length 580
Comment pep:known_by_projection scaffold:OtoGar3:GL873542.1:1784223:1806318:1 gene:ENSOGAG00000000951 transcript:ENSOGAT00000000952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRPEVLDELPAACLSPCGPPNPAELFSEARRLALEELVAGGPDAFAAFLRRERLGRFL
NPDEVHAILSAAEQPGEEGAAAEDSFGSSHDCSSGTYFPEQSDLEPPLLELGWPAFYQGA
YRGATRVEAHFQPRGAGAGGPYGCKDALRQQLRSAREVIAVVMDVFTDIDIFRDLQEICR
KQGVAVYILLDQSLLSQFLDMCMDLKVHPEQEKLMTVRTITGNIYYARSGTKIVGKVHEK
FTLIDGIRVATGSYSFTWTDGKLNSSNLVILSGQVVEHFDLEFRILYAQSTPISPKLLSN
FQISNKFDHLVDQKPQSKELTLGNLLRVRLARLSSTPKKSDLESEVPPEDKTETKRHDSG
SSTLSEEEHFNSHENEPESRKSADVATQTEPGEEVRAVHVGTQVSTAMACAGTQAAVPTR
GVSSQTMVWSKSATTQTDSDEHMLFTQGTPSKEGSPVSKMSVSRSSSLKSSSSLSSQGSV
ASSTGSHASIRATDVHSPGYPKYLGTPHLDLYLRDSFRNLNNERQFHFAGIRSRLNHMLA
MLSRRTFLTENYLGFNSGNFNRAPVNLLAIRDITLYPSYQ
Download sequence
Identical sequences H0WHK1
ENSOGAP00000000851 ENSOGAP00000000851 XP_012659302.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]