SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000875 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000875
Domain Number 1 Region: 39-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000875   Gene: ENSOGAG00000000980   Transcript: ENSOGAT00000000981
Sequence length 152
Comment pep:known_by_projection scaffold:OtoGar3:GL873527.1:17203901:17204359:1 gene:ENSOGAG00000000980 transcript:ENSOGAT00000000981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSCKPSGPPAGARAAPQCAGGAECAGSCAGAGRLESAARRRLAANARERRRMQGLNTAF
DRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVSLHCEHFGRDH
YLPFAGAKLPGESEPYGQRLFGFQPEPFQMAS
Download sequence
Identical sequences H0WHM0
XP_003783664.1.62490 ENSOGAP00000000875 ENSOGAP00000000875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]