SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000911 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000911
Domain Number 1 Region: 153-418
Classification Level Classification E-value
Superfamily RNI-like 2.35e-23
Family 28-residue LRR 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000911   Gene: ENSOGAG00000001019   Transcript: ENSOGAT00000001020
Sequence length 477
Comment pep:novel scaffold:OtoGar3:GL873586.1:9248145:9252837:1 gene:ENSOGAG00000001019 transcript:ENSOGAT00000001020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKMSRQGAPRLLDLAVQSLVRNEALAMSALEELPGELFPPLFMEAFTRRRSRVLTAMVQA
WPFTRLPLGSLMNLRDLEMLRAVLDGLDALLAQKDQPRKWNLQVLDLRDVDGNFWAVWSE
GMAHTCPPDAMDERKTETDCPGSGRVKPFRVIVDLCLNVRTLDESLKYFSEWAKQRKDSI
HLCCRELDILAVAFQNIRKFLQTVDLDCIQEVELNCYWNLPTLGQFSSYLGRMRHLEKLC
VSHIRAPAYLSPEMKKKHVLQMANALLNLDRLQKLDLYSDAFLEGHLDQVLRCLKTPLET
LSIIRCPLLESDLSHLSWCPTLTELKHLVLSKVRLTDFSPEPLQLLLERVAATLQTLDLE
DCGISDAQLRVILPSLSRCSQLTTFSFCGNQIFMPALEDLLRHTVRLSKFNIGQYPVPLE
SYDAWGVFHQEILAQFAAKLRRTLSDLQLKRIFFGTVPCPECGNGALYDLDMVRHCC
Download sequence
Identical sequences H0WHP8
ENSOGAP00000000911 ENSOGAP00000000911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]